Result : EXP01215
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01215 |
| NCBI Accession ID | NC_017381.1 |
| Organism | Helicobacter pylori 2018 |
| Left | 270675 |
| Right | 270950 |
| Strand | + |
| Nucleotide Sequence | ATGGGAAATCCAAATCAATTAAGGAAAGAGTCAATGAAATTAGTTTTAGCCAAGAATACGAGAAAATCAGACGCTAAGAGCGTGGAATTAGAGGATTTGTATAAAAAATTCAATGAAGACAAGCGTTCTATTTTCTATCTTGCCCCCACGAACGCCCATAAGGACATGCTTAAGGCGGTGGATTTTTTCAAAGAAAAAGGCCATACGGCTTATTTAGATGAGGTGAGGGTCAGCACTGATGAAAAAGATTTTCTTTATGAATTGCACATTATTTAA |
| Sequence | MGNPNQLRKESMKLVLAKNTRKSDAKSVELEDLYKKFNEDKRSIFYLAPTNAHKDMLKAVDFFKEKGHTAYLDEVRVSTDEKDFLYELHII |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of pfam18618. Profile Description: HP0268. HP0268 is a small, characterized protein that is conserved in H. pylori strains and consists of 80 amino acid residues with a molecular weight of approximately 9.5 kDa. HP0268 has nicking endonuclease and RNase activities, both of which are specific for a single-strand of nucleotides. It is structurally similar to small MutS-related (SMR) domains, that can be categorized roughly into three subfamilies according to their arrangement in the domain architecture.HP0268 falls into subfamily 3 that is found as stand-alone type proteins. It is proposed that HP0268 has become an evolutionary intermediate between RNases and nicking endonucleases during H. pylori adaptation to the extremely acidic environment of the stomach. |
| Pubmed ID | 30796087 |
| Domain | CDD:408400 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 268145 | 268387 | + | NC_017379.1 | Helicobacter pylori Puno135 |
| 2 | 497324 | 497566 | - | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017379.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01555.20 | 1.0 | 2 | 5871.0 | same-strand | DNA methylase |
| 2 | PF07724.16 | 1.0 | 2 | 3226.5 | same-strand | AAA domain (Cdc48 subfamily) |
| 3 | PF17871.3 | 1.0 | 2 | 3226.5 | same-strand | AAA lid domain |
| 4 | PF00004.31 | 1.0 | 2 | 3226.5 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 5 | PF10431.11 | 1.0 | 2 | 3226.5 | same-strand | C-terminal, D2-small domain, of ClpB protein |
| 6 | PF07728.16 | 1.0 | 2 | 3226.5 | same-strand | AAA domain (dynein-related subfamily) |
| 7 | PF02861.22 | 1.0 | 2 | 3226.5 | same-strand | Clp amino terminal domain, pathogenicity island component |
| 8 | PF02683.17 | 1.0 | 2 | 2429.0 | same-strand | Cytochrome C biogenesis protein transmembrane region |
| 9 | PF01979.22 | 1.0 | 2 | 68.5 | same-strand | Amidohydrolase family |
| 10 | PF04055.23 | 1.0 | 2 | 10.0 | same-strand | Radical SAM superfamily |
| 11 | PF00919.22 | 1.0 | 2 | 10.0 | same-strand | Uncharacterized protein family UPF0004 |
| 12 | PF04028.15 | 1.0 | 2 | 1348.5 | same-strand | Domain of unknown function (DUF374) |
++ More..