Result : EXP01212
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01212 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli K12 |
| Left | 1908261 |
| Right | 1908548 |
| Strand | - |
| Nucleotide Sequence | ATGAACGAAGTTGTAAATTCAGGCGTGATGAACATTGCGTCTTTGGTTGTATCGGTGGTGGTTCTTCTTATCGGGCTCATCTTGTGGTTTTTTATCAATCGTGCCAGTTCACGGACTAACGAACAGATTGAACTGCTTGAGGCGTTGCTGGATCAGCAAAAACGTCAAAATGCACTGTTACGTCGTTTGTGCGAAGCAAACGAACCAGAGAAAGCAGATAAAAAGACCGTTGAGAGTCAAAAATCGGTTGAAGACGAAGATATTATTCGTCTGGTCGCCGAACGATAA |
| Sequence | MNEVVNSGVMNIASLVVSVVVLLIGLILWFFINRASSRTNEQIELLEALLDQQKRQNALLRRLCEANEPEKADKKTVESQKSVEDEDIIRLVAER |
| Source of smORF | Protein-level |
| Function | integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] The ORF matches to the profile of pfam13974. Profile Description: YebO-like protein. This short protein is uncharacterized. It seems likely to be of phage origin as it is found in Enterobacteria phage HK022 Gp20 and Enterobacteria phage HK97 Gp15. The protein is also found in a variety of enteric bacteria. |
| Pubmed ID | 30796087 |
| Domain | CDD:404798 |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | P64501 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 60
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1908261 | 1908548 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 2510227 | 2510514 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 1440972 | 1441259 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 1809960 | 1810247 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 1941588 | 1941875 | + | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 1841173 | 1841460 | - | NZ_AP014857.1 | Escherichia albertii |
| 7 | 1936558 | 1936845 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 8 | 1984654 | 1984941 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 9 | 1799602 | 1799901 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 10 | 1546179 | 1546469 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 11 | 2789012 | 2789299 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 12 | 4153491 | 4153778 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 13 | 562094 | 562378 | - | NZ_CP033744.1 | Citrobacter freundii |
| 14 | 691181 | 691471 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 15 | 2225706 | 2225996 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 16 | 1965258 | 1965548 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 17 | 4521176 | 4521460 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 18 | 2019121 | 2019411 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 19 | 237771 | 238058 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 20 | 3539481 | 3539765 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 21 | 123516 | 123806 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 22 | 4491293 | 4491583 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 23 | 1367046 | 1367327 | - | NZ_CP038469.1 | Citrobacter tructae |
| 24 | 2799471 | 2799761 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 25 | 1116796 | 1117083 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 26 | 2798422 | 2798712 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 27 | 603930 | 604217 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 28 | 2852183 | 2852470 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 29 | 3336789 | 3337079 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 30 | 1948369 | 1948659 | + | NZ_CP054254.1 | Klebsiella variicola |
| 31 | 1881217 | 1881507 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 32 | 2776037 | 2776327 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 33 | 262340 | 262627 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 34 | 1880347 | 1880637 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 35 | 4447574 | 4447861 | - | NZ_CP053416.1 | Salmonella bongori |
| 36 | 2539528 | 2539815 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 37 | 4259438 | 4259710 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 38 | 3768002 | 3768292 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 39 | 2981468 | 2981758 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 40 | 1826149 | 1826427 | + | NZ_LR134201.1 | Cedecea lapagei |
| 41 | 1900340 | 1900621 | + | NZ_CP023525.1 | Cedecea neteri |
| 42 | 2887663 | 2887953 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 43 | 5212329 | 5212613 | - | NZ_CP026047.1 | Raoultella planticola |
| 44 | 2064872 | 2065156 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 45 | 2343064 | 2343354 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 46 | 1990364 | 1990648 | + | NZ_CP041247.1 | Raoultella electrica |
| 47 | 1892186 | 1892479 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 48 | 1822188 | 1822481 | + | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 49 | 2678534 | 2678833 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 50 | 2252126 | 2252416 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 51 | 2012014 | 2012304 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 52 | 1629787 | 1630074 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 53 | 4061918 | 4062211 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 54 | 2596755 | 2597042 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 55 | 2105243 | 2105533 | + | NZ_CP050508.1 | Raoultella terrigena |
| 56 | 894887 | 895174 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 57 | 2555530 | 2555817 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 58 | 2729885 | 2730175 | - | NC_015968.1 | Enterobacter soli |
| 59 | 1917065 | 1917352 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 60 | 1462948 | 1463229 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 61 | 2514609 | 2514896 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP045205.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06173.14 | 0.72 | 43 | 4707.0 | opposite-strand | Protein of unknown function (DUF986) |
| 2 | PF02659.17 | 0.97 | 58 | 3793 | opposite-strand | Putative manganese efflux pump |
| 3 | PF13649.8 | 1.0 | 60 | 2995 | same-strand | Methyltransferase domain |
| 4 | PF08241.14 | 1.0 | 60 | 2995 | same-strand | Methyltransferase domain |
| 5 | PF00313.24 | 0.98 | 59 | 905.5 | same-strand | 'Cold-shock' DNA-binding domain |
| 6 | PF13996.8 | 1.0 | 60 | 378 | opposite-strand | YobH-like protein |
| 7 | PF01614.20 | 1.0 | 60 | 681 | same-strand | Bacterial transcriptional regulator |
| 8 | PF09339.12 | 1.0 | 60 | 681 | same-strand | IclR helix-turn-helix domain |
| 9 | PF13412.8 | 1.0 | 60 | 681 | same-strand | Winged helix-turn-helix DNA-binding |
| 10 | PF07690.18 | 0.85 | 51 | 1654.0 | opposite-strand | Major Facilitator Superfamily |
| 11 | PF01435.20 | 0.97 | 58 | 3082 | same-strand | Peptidase family M48 |
| 12 | PF17804.3 | 0.65 | 39 | 4171.5 | same-strand | Tail specific protease N-terminal domain |
| 13 | PF03572.20 | 0.65 | 39 | 4171.5 | same-strand | Peptidase family S41 |
| 14 | PF11818.10 | 0.65 | 39 | 4171.5 | same-strand | C-terminal domain of tail specific protease (DUF3340) |
| 15 | PF00595.26 | 0.65 | 39 | 4171.5 | same-strand | PDZ domain |
| 16 | PF17820.3 | 0.65 | 39 | 4171.5 | same-strand | PDZ domain |
| 17 | PF00905.24 | 0.63 | 38 | 1243.0 | same-strand | Penicillin binding protein transpeptidase domain |
| 18 | PF03717.17 | 0.63 | 38 | 1243.0 | same-strand | Penicillin-binding Protein dimerisation domain |
++ More..