Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01210 |
NCBI Accession ID | NC_007633.1 |
Organism | Mycoplasma capricolum subsp. capricolum ATCC 27343 |
Left | 69481 |
Right | 69696 |
Strand | - |
Nucleotide Sequence | ATGAATAATGAAAACAAAAGTTATGATGAACTAATTTCTGAAATTAAAGAAGATACTAAAAAACTATCAAGCAATGAAATTTCAGTTGAACAAGCTATGGAAATTTTTGAACAAAATATTAAAAAGATTAAACTAGCAAAAGAAAAATTAACTCAATACAAGGGTCAAATTAATAAAGTAATGCAAGATGATGAGTTAGAAGAATTTAAAGACTAA |
Sequence | MNNENKSYDELISEIKEDTKKLSSNEISVEQAMEIFEQNIKKIKLAKEKLTQYKGQINKVMQDDELEEFKD |
Source of smORF | Protein-level |
Function | The ORF matches to the profile of cl00750. Profile Description: Exonuclease VII small subunit. This protein is the small subunit for exodeoxyribonuclease VII. Exodeoxyribonuclease VII is made of a complex of four small subunits to one large subunit. The complex degrades single-stranded DNA into large acid-insoluble oligonucleotides. These nucleotides are then degraded further into acid-soluble oligonucleotides. [DNA metabolism, Degradation of DNA] |
Pubmed ID | 30796087 |
Domain | CDD:412547 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 71 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 69481 | 69696 | - | NC_007633.1 | Mycoplasma capricolum subsp. capricolum ATCC 27343 |
2 | 144315 | 144530 | - | NZ_CP001668.1 | Mycoplasma mycoides subsp. capri str. GM12 |
3 | 301197 | 301412 | + | NZ_CP007520.1 | Mycoplasma yeatsii GM274B |
4 | 406300 | 406506 | - | NZ_CP024411.1 | Mesoplasma entomophilum |
5 | 440512 | 440718 | - | NZ_CP024964.1 | Entomoplasma melaleucae |
6 | 388061 | 388267 | - | NC_006055.1 | Mesoplasma florum L1 |
7 | 424959 | 425165 | - | NZ_CP024969.1 | Mesoplasma tabanidae |
8 | 419760 | 419966 | - | NZ_CP023173.1 | Mesoplasma chauliocola |
9 | 503624 | 503839 | - | NZ_LS991954.1 | Mycoplasma putrefaciens |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01479.27 | 0.78 | 7 | 0 | same-strand | S4 domain |