Result : EXP01210
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01210 |
| NCBI Accession ID | NC_007633.1 |
| Organism | Mycoplasma capricolum subsp. capricolum ATCC 27343 |
| Left | 69481 |
| Right | 69696 |
| Strand | - |
| Nucleotide Sequence | ATGAATAATGAAAACAAAAGTTATGATGAACTAATTTCTGAAATTAAAGAAGATACTAAAAAACTATCAAGCAATGAAATTTCAGTTGAACAAGCTATGGAAATTTTTGAACAAAATATTAAAAAGATTAAACTAGCAAAAGAAAAATTAACTCAATACAAGGGTCAAATTAATAAAGTAATGCAAGATGATGAGTTAGAAGAATTTAAAGACTAA |
| Sequence | MNNENKSYDELISEIKEDTKKLSSNEISVEQAMEIFEQNIKKIKLAKEKLTQYKGQINKVMQDDELEEFKD |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl00750. Profile Description: Exonuclease VII small subunit. This protein is the small subunit for exodeoxyribonuclease VII. Exodeoxyribonuclease VII is made of a complex of four small subunits to one large subunit. The complex degrades single-stranded DNA into large acid-insoluble oligonucleotides. These nucleotides are then degraded further into acid-soluble oligonucleotides. [DNA metabolism, Degradation of DNA] |
| Pubmed ID | 30796087 |
| Domain | CDD:412547 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 69481 | 69696 | - | NC_007633.1 | Mycoplasma capricolum subsp. capricolum ATCC 27343 |
| 2 | 144315 | 144530 | - | NZ_CP001668.1 | Mycoplasma mycoides subsp. capri str. GM12 |
| 3 | 301197 | 301412 | + | NZ_CP007520.1 | Mycoplasma yeatsii GM274B |
| 4 | 406300 | 406506 | - | NZ_CP024411.1 | Mesoplasma entomophilum |
| 5 | 440512 | 440718 | - | NZ_CP024964.1 | Entomoplasma melaleucae |
| 6 | 388061 | 388267 | - | NC_006055.1 | Mesoplasma florum L1 |
| 7 | 424959 | 425165 | - | NZ_CP024969.1 | Mesoplasma tabanidae |
| 8 | 419760 | 419966 | - | NZ_CP023173.1 | Mesoplasma chauliocola |
| 9 | 503624 | 503839 | - | NZ_LS991954.1 | Mycoplasma putrefaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007633.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01479.27 | 0.78 | 7 | 0 | same-strand | S4 domain |
++ More..