Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01209 |
NCBI Accession ID | NC_017340.1 |
Organism | Staphylococcus aureus 04-02981 |
Left | 725635 |
Right | 725934 |
Strand | + |
Nucleotide Sequence | ATGCATGAACAAGATTTTAGAATTTTAGAGGGTCAAGATATTACTTTGCCAGAATTAGGTAGAGAATTAGAAAATATTACAGGACATACGATTGCTGATTCTACTGGCGAAATTAAGCGTGTAATTGCACATTTACCAAACTTTGAGTCCGATACAGATACTTTTGTTGCTACATATCGTTTAAACCATCAACAAGATTTTATAGATGCAACTTTTACTGCGCTGAAATCAGATAGAGCACGTTTAAAAGAAGTGCCAGTTCATGTTGAACTTATAAGTTATATTTCTAAATCAAAATAA |
Sequence | MHEQDFRILEGQDITLPELGRELENITGHTIADSTGEIKRVIAHLPNFESDTDTFVATYRLNHQQDFIDATFTALKSDRARLKEVPVHVELISYISKSK |
Source of smORF | Protein-level |
Function | |
Pubmed ID | 30796087 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 99 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 671908 | 672207 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
2 | 693173 | 693472 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
3 | 44181 | 44477 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
4 | 2250037 | 2250333 | - | NZ_AP018587.1 | Staphylococcus caprae |
5 | 1915283 | 1915579 | - | NZ_CP065712.1 | Staphylococcus auricularis |
6 | 2186735 | 2187031 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
7 | 1060331 | 1060627 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
8 | 2179851 | 2180147 | - | NZ_CP008724.1 | Staphylococcus xylosus |
9 | 691979 | 692278 | + | NZ_LT906460.1 | Staphylococcus simiae |
10 | 1402984 | 1403280 | - | NZ_CP018199.1 | Staphylococcus succinus |
11 | 2040192 | 2040488 | - | NZ_LR134242.1 | Staphylococcus warneri |
12 | 1883071 | 1883367 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
13 | 2106373 | 2106669 | - | NZ_CP064056.1 | Staphylococcus lloydii |
14 | 546310 | 546606 | + | NZ_CP013114.1 | Staphylococcus equorum |
15 | 408163 | 408459 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
16 | 2091825 | 2092121 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
17 | 1261359 | 1261655 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
18 | 543702 | 543998 | - | NZ_CP033732.1 | Staphylococcus hominis |
19 | 2127857 | 2128153 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
20 | 1695880 | 1696179 | + | NZ_CP020773.1 | Staphylococcus lutrae |
21 | 425006 | 425305 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
22 | 368857 | 369156 | + | NZ_CP045927.1 | Staphylococcus agnetis |
23 | 270967 | 271266 | - | NZ_CP027770.1 | Staphylococcus felis |
24 | 2129185 | 2129484 | - | NZ_CP008747.1 | Staphylococcus hyicus |
25 | 355463 | 355762 | + | NZ_LT906464.1 | Staphylococcus muscae |
26 | 2316538 | 2316849 | - | NZ_CP018776.1 | Staphylococcus condimenti |
27 | 2554248 | 2554559 | - | NZ_CP033460.1 | Staphylococcus debuckii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04306.15 | 0.93 | 25 | 1965 | same-strand | Protein of unknown function (DUF456) |
2 | PF06570.13 | 0.93 | 25 | 1137 | opposite-strand | Protein of unknown function (DUF1129) |
3 | PF00583.27 | 0.89 | 24 | 191.5 | same-strand | Acetyltransferase (GNAT) family |
4 | PF13302.9 | 1.0 | 27 | 121 | same-strand | Acetyltransferase (GNAT) domain |
5 | PF03641.16 | 1.0 | 27 | 973 | opposite-strand | Possible lysine decarboxylase |
6 | PF02639.16 | 0.89 | 24 | 1546.0 | opposite-strand | Uncharacterized BCR, YaiI/YqxD family COG1671 |