Result : B2KB84
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L35 |
| NCBI Accession ID | CP001055.1 |
| Organism | Elusimicrobium minutum (strain Pei191) |
| Left | 373274 |
| Right | 373477 |
| Strand | + |
| Nucleotide Sequence | ATGCCAAAGTTAAAAAACCACAGCGGCGCGAAAAAGAGATTTGCAAAAACCGCTACAGGTAAATATAAACGCAGAAAAGCCGGCAGAAAGCATTTGCTTACGCCGCAATCGGGCTCACGCAAGAGAGAAATGAGACAGACGGGTATTATTAAACCGGAATCTGCCGAAGGAAAACTCCTTAAAAAATATTTACCGATGGACTAG |
| Sequence | MPKLKNHSGAKKRFAKTATGKYKRRKAGRKHLLTPQSGSRKREMRQTGIIKPESAEGKLLKKYLPMD |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00392. Profile Description: Ribosomal protein L35. This ribosomal protein is found in bacteria and organelles only. It is not closely related to any eukaryotic or archaeal ribosomal protein. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 19270133 |
| Domain | CDD:412354 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B2KB84 |
| ORF Length (Amino Acid) | 67 |
++ More..
| Conservation Analysis |
No. of Species: 46
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 373274 | 373477 | + | NC_010644.1 | Elusimicrobium minutum Pei191 |
| 2 | 2311684 | 2311881 | - | NZ_HG917868.1 | Clostridium bornimense |
| 3 | 1615160 | 1615357 | + | NZ_CP040924.1 | Clostridium thermarum |
| 4 | 1839630 | 1839827 | - | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 5 | 1610228 | 1610425 | + | NZ_CP014176.1 | Clostridium argentinense |
| 6 | 2388455 | 2388652 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 7 | 800578 | 800775 | + | NZ_CP016786.1 | Clostridium isatidis |
| 8 | 1437079 | 1437276 | - | NZ_CP016786.1 | Clostridium isatidis |
| 9 | 2398498 | 2398695 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 10 | 1042224 | 1042421 | + | NZ_CP041242.1 | Lysobacter alkalisoli |
| 11 | 1251381 | 1251578 | + | NZ_CP029843.1 | Lysobacter maris |
| 12 | 1921318 | 1921515 | - | NZ_LT906477.1 | Clostridium cochlearium |
| 13 | 1373663 | 1373857 | + | NC_016940.1 | Saprospira grandis str. Lewin |
| 14 | 722047 | 722244 | + | NC_014011.1 | Aminobacterium colombiense DSM 12261 |
| 15 | 1451875 | 1452069 | + | NC_013037.1 | Dyadobacter fermentans DSM 18053 |
| 16 | 775796 | 775993 | - | NZ_CP070062.1 | Coprococcus comes |
| 17 | 1353798 | 1353995 | + | NZ_CP030775.1 | Clostridium butyricum |
| 18 | 1796855 | 1797052 | + | NZ_CP043998.1 | Clostridium diolis |
| 19 | 1895967 | 1896161 | - | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 20 | 1591398 | 1591595 | - | NZ_CP016878.1 | Xanthomonas hortorum |
| 21 | 2403488 | 2403685 | + | NZ_CP042218.1 | Luteimonas granuli |
| 22 | 1773115 | 1773312 | - | NZ_CP014204.2 | Clostridium baratii |
| 23 | 2822094 | 2822291 | - | NZ_CP023406.1 | Luteimonas chenhongjianii |
| 24 | 1215653 | 1215850 | + | NZ_CP046570.1 | Xanthomonas albilineans |
| 25 | 382302 | 382502 | + | NC_013861.1 | Legionella longbeachae NSW150 |
| 26 | 1604616 | 1604813 | + | NZ_CP012900.1 | Stenotrophomonas acidaminiphila |
| 27 | 2969589 | 2969786 | - | NZ_LT853882.1 | Xanthomonas fragariae |
| 28 | 1556875 | 1557072 | + | NZ_CP007810.1 | Xanthomonas oryzae pv. oryzicola |
| 29 | 2163211 | 2163408 | + | NZ_CP033326.1 | Xanthomonas cucurbitae |
| 30 | 1983243 | 1983440 | + | NZ_CP028127.1 | Xanthomonas vasicola pv. vasculorum |
| 31 | 4190247 | 4190444 | + | NZ_CP043476.1 | Xanthomonas hyacinthi |
| 32 | 1968007 | 1968204 | + | NZ_CP058243.1 | Xanthomonas campestris pv. raphani |
| 33 | 2995883 | 2996080 | - | NZ_CP072268.1 | Xanthomonas euvesicatoria pv. alfalfae |
| 34 | 911755 | 911952 | - | NZ_CP018725.1 | Xanthomonas vesicatoria ATCC 35937 |
| 35 | 5814705 | 5814905 | + | NZ_CP036276.1 | Symmachiella dynata |
| 36 | 2726510 | 2726704 | - | NZ_CP012836.1 | Algoriphagus sanaruensis |
| 37 | 4140479 | 4140679 | + | NZ_CP025491.2 | Legionella sainthelensi |
| 38 | 3075182 | 3075382 | - | NZ_CP013742.1 | Legionella pneumophila |
| 39 | 3110410 | 3110607 | - | NZ_CP048044.1 | Xanthomonas citri |
| 40 | 3170603 | 3170800 | - | NZ_CP037883.1 | Stenotrophomonas indicatrix |
| 41 | 165651 | 165848 | - | NZ_CP063145.1 | Cruoricaptor ignavus |
| 42 | 697622 | 697819 | + | NC_014033.1 | Prevotella ruminicola 23 |
| 43 | 427834 | 428031 | + | NC_017045.1 | Riemerella anatipestifer ATCC 11845 = DSM 15868 |
| 44 | 2951359 | 2951559 | - | NZ_LN614830.1 | Tatlockia micdadei |
| 45 | 3405666 | 3405866 | - | NZ_LT906442.1 | Legionella waltersii |
| 46 | 1663812 | 1664012 | + | NZ_CP036353.1 | Gimesia maris |
| 47 | 8445329 | 8445538 | + | NZ_CP022163.1 | Melittangium boletus DSM 14713 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_HG917868.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00707.24 | 0.96 | 44 | 100.5 | same-strand | Translation initiation factor IF-3, C-terminal domain |
| 2 | PF00453.20 | 1.0 | 46 | 17 | same-strand | Ribosomal protein L20 |
| 3 | PF01409.22 | 0.76 | 35 | 656 | same-strand | tRNA synthetases class II core domain (F) |
| 4 | PF02912.20 | 0.76 | 35 | 656 | same-strand | Aminoacyl tRNA synthetase class II, N-terminal domain |
| 5 | PF00587.27 | 0.74 | 34 | 836.5 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |
| 6 | PF03129.22 | 0.74 | 34 | 836.5 | same-strand | Anticodon binding domain |
| 7 | PF02824.23 | 0.72 | 33 | 835 | same-strand | TGS domain |
| 8 | PF07973.16 | 0.74 | 34 | 836.5 | same-strand | Threonyl and Alanyl tRNA synthetase second additional domain |
++ More..