Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01207 |
NCBI Accession ID | NC_000908.2 |
Organism | Mycoplasma genitalium G37 |
Left | 159798 |
Right | 160100 |
Strand | + |
Nucleotide Sequence | ATGAGTTTTAAAAAGATTGCTGAAATGATGCGTCAAGCAGAACGAGAAACTAAGAAAAAAACATTAGCGTTTGAACAACAAGCCTTTGAATACAACTATAAAAATGGTGCGATTAAGATCACTATTTTAGGTGATCTTACACTTAAATCAATTAACATCGATCCTGTTTTGATTGATGCAAGTGACAAAGTTATTCTAGAGGAGATGATTATAGAAGCTACTAATGAAGCGGTTAGTGATGTGAAAACCAAGTATGATAACTTAGTTGAGAAAACTATGCCAAAAGTTCCAGGTCTTTTCTAA |
Sequence | MSFKKIAEMMRQAERETKKKTLAFEQQAFEYNYKNGAIKITILGDLTLKSINIDPVLIDASDKVILEEMIIEATNEAVSDVKTKYDNLVEKTMPKVPGLF |
Source of smORF | Protein-level |
Function | DNA binding [GO:0003677] The ORF matches to the profile of cl00494. Profile Description: YbaB/EbfC DNA-binding family. The function of this protein is unknown, but it has been expressed and crystallized. Its gene nearly always occurs next to recR and/or dnaX. It is restricted to Bacteria and the plant Arabidopsis. The plant form contains an additional N-terminal region that may serve as a transit peptide and shows a close relationship to the cyanobacterial member, suggesting that it is a chloroplast protein. Members of this family are found in a single copy per bacterial genome, but are broadly distributed. A member is present even in the minimal gene complement of Mycoplasm genitalium. [Unknown function, General] |
Pubmed ID | 30796087 |
Domain | CDD:412410 |
Functional Category | Gene Ontology/Expression based functional assignment |
Uniprot ID | P75502 |
ORF Length (Amino Acid) | 100 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 159798 | 160100 | + | NC_000908.2 | Mycoplasma genitalium G37 |
2 | 324048 | 324350 | + | NZ_CP010546.1 | Mycoplasma pneumoniae FH |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01230.25 | 1.0 | 2 | 791.5 | opposite-strand | HIT domain |
2 | PF11969.10 | 1.0 | 2 | 791.5 | opposite-strand | Scavenger mRNA decapping enzyme C-term binding |
3 | PF01336.27 | 1.0 | 2 | 868.5 | same-strand | OB-fold nucleic acid binding domain |