Result : EXP01205
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01205 |
| NCBI Accession ID | AE015928.1 |
| Organism | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) |
| Left | 5009172 |
| Right | 5009474 |
| Strand | + |
| Nucleotide Sequence | ATGGGAATGTTTTTCAATTCGATGAGAAAACCTCGAGGCTTTAATCATCAATACATTTACGTAAACGAGCGGAAAGAAAAGCTTGAGAAGATGGAGGAGAAGGCGAAACGCGAGTTGGGAATGCTTCCGGATAAAGAATTCAGTCCCGAAGATATCCGTGGTAAGTTTGTCGAAGGTACGACGCACCTGAAGCGCAGAAAGGCAAGTGGCCGTAAGCCTGTATCTTTTGGAATCATATTGATTATCATAGCTTTCCTTTTATATTTGTGGCATTATTTAGCGACGGGAAGCTGGTCATTTTAA |
| Sequence | MGMFFNSMRKPRGFNHQYIYVNERKEKLEKMEEKAKRELGMLPDKEFSPEDIRGKFVEGTTHLKRRKASGRKPVSFGIILIIIAFLLYLWHYLATGSWSF |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 31841667 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2310547 | 2310849 | + | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 2 | 4554568 | 4554864 | - | NZ_LN877293.1 | Bacteroides fragilis |
| 3 | 5156569 | 5156868 | + | NZ_CP012938.1 | Bacteroides ovatus |
| 4 | 333926 | 334225 | + | NZ_CP015401.2 | Bacteroides caecimuris |
| 5 | 1858856 | 1859146 | - | NZ_CP027234.1 | Bacteroides heparinolyticus |
| 6 | 256170 | 256460 | - | NC_014933.1 | Bacteroides helcogenes P 36-108 |
| 7 | 1809508 | 1809798 | - | NZ_CP027231.1 | Bacteroides zoogleoformans |
| 8 | 608242 | 608538 | - | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
| 9 | 671690 | 671986 | - | NZ_LR699004.1 | Phocaeicola dorei |
| 10 | 3497405 | 3497701 | + | NC_015164.1 | Phocaeicola salanitronis DSM 18170 |
| 11 | 3066450 | 3066746 | - | NZ_CP069440.1 | Phocaeicola coprophilus |
| 12 | 1927207 | 1927503 | - | NZ_LR215980.1 | Paraprevotella xylaniphila YIT 11841 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP040530.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00478.27 | 0.83 | 10 | 5540.0 | same-strand | IMP dehydrogenase / GMP reductase domain |
| 2 | PF00571.30 | 0.83 | 10 | 5540.0 | same-strand | CBS domain |
| 3 | PF13616.8 | 1.0 | 12 | 3960 | same-strand | PPIC-type PPIASE domain |
| 4 | PF00639.23 | 1.0 | 12 | 1788 | same-strand | PPIC-type PPIASE domain |
| 5 | PF13145.8 | 0.67 | 8 | 3053.0 | same-strand | PPIC-type PPIASE domain |
| 6 | PF13100.8 | 1.0 | 12 | 3.0 | same-strand | OstA-like protein |
| 7 | PF01119.21 | 1.0 | 12 | 17.0 | same-strand | DNA mismatch repair protein, C-terminal domain |
| 8 | PF08676.13 | 1.0 | 12 | 17.0 | same-strand | MutL C terminal dimerisation domain |
++ More..