ProsmORF-pred
Result : EXP01204
Protein Information
Information Type Description
Protein name EXP01204
NCBI Accession ID CP015405.2
Organism Blautia sp. YL58
Left 1018325
Right 1018627
Strand +
Nucleotide Sequence ATGAGCAAGGAAAAATACTGGGAGGGCAAACAGTACGCCTTTTTCAGCCATAAGGACTGTGAATACTTTCCCTGTCACAAAACAAATGACACGGAAAATTTTAACTGCCTGTTCTGCTACTGTCCTTTGTACGCTCTGGGCGACCAGTGCGGAGGAAATTTTCACTATACCAAAGAAGGCATCAAGGACTGCAGCAAATGCGGCCTTCCCCATAAAAGGGATAATTTCGGGTACATTACAGGCAAATATAACGAGATCATGGAGATTGCAAAAAAGAACCGCAGGAATCCAGATAAGGAATAA
Sequence MSKEKYWEGKQYAFFSHKDCEYFPCHKTNDTENFNCLFCYCPLYALGDQCGGNFHYTKEGIKDCSKCGLPHKRDNFGYITGKYNEIMEIAKKNRRNPDKE
Source of smORF Protein-level
Function The ORF matches to the profile of cl00946. Profile Description: Cysteine-rich small domain. Probable metal-binding domain.
Pubmed ID 31841667
Domain CDD:412667
Functional Category Conserved domain based functional assignment
Uniprot ID
ORF Length (Amino Acid) 100
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 23
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 2266891 2267193 + NZ_CP039126.1 Blautia producta
2 1748808 1749107 + NZ_CP030280.1 Blautia argi
3 1746577 1746882 - NZ_CP022413.2 Blautia hansenii DSM 20583
4 2980302 2980562 - NZ_CP048649.1 Aminipila butyrica
5 2121980 2122258 - NZ_CP048436.1 Flavonifractor plautii
6 3143933 3144235 - NZ_CP048436.1 Flavonifractor plautii
7 3108483 3108743 + NZ_CP019870.1 Clostridioides difficile
8 2165149 2165409 + NZ_CP036523.1 Peptacetobacter hiranonis
9 3131884 3132141 + NZ_CP014150.1 Paeniclostridium sordellii
10 1867661 1867936 - NZ_CP040058.1 Anaerostipes rhamnosivorans
11 189734 189997 - NZ_LR590481.1 Hathewaya histolytica
12 2330120 2330395 + NC_016894.1 Acetobacterium woodii DSM 1030
13 583443 583739 + NC_014633.1 Ilyobacter polytropus DSM 2926
14 1915085 1915363 + NC_014624.2 Eubacterium callanderi
15 2162269 2162553 + NZ_CP028102.1 Fusobacterium mortiferum ATCC 9817
16 3647320 3647598 + NZ_CP019962.1 Eubacterium limosum
17 558898 559176 + NZ_CP029487.1 Eubacterium maltosivorans
18 658757 659017 - NC_018664.1 Gottschalkia acidurici 9a
19 504070 504375 + NC_014632.1 Ilyobacter polytropus DSM 2926
20 2584140 2584436 + NZ_CP028105.1 Fusobacterium ulcerans
21 3735966 3736223 - NC_015275.1 Cellulosilyticum lentocellum DSM 5427
22 1523632 1523889 + NZ_CP017111.1 Sulfurospirillum halorespirans DSM 13726
23 1508807 1509064 + NZ_CP007201.1 Sulfurospirillum multivorans DSM 12446
24 2563475 2563741 + NC_015687.1 Clostridium acetobutylicum DSM 1731
25 684260 684520 + NZ_LR134523.1 Peptoniphilus ivorii
++ More..