Result : EXP01199
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01199 |
| NCBI Accession ID | ABAX03000038.1 |
| Organism | Anaerostipes caccae (strain DSM 14662 / NCIMB 13811 / L1-92) |
| Left | 82914 |
| Right | 83210 |
| Strand | + |
| Nucleotide Sequence | ATGAAGAAGGAGAAATTAGGAACGAATTATTTGAAAGATGGAAATGGGGGCGGATTTGTAGTATCCTATTATATGCTGAATGATTCTGCCAGAGGAAGCTACGGCGCCGCACTGGAGAGAACGACCGGAGAGCCGGAAGTTCTTGAGACAGAAGAGGTAAGAGAGGCCTTTTTGAACAGACAGGAAGCAGAACATTTCATTCGGCTGCTGATCAAATATGAAGTGACACCGATTTCTTTTTTTGAGAGTTTGGATGCGGTGATGGAGTTGGAGGAGAAAATTGAAGGAATACTATGA |
| Sequence | MKKEKLGTNYLKDGNGGGFVVSYYMLNDSARGSYGAALERTTGEPEVLETEEVREAFLNRQEAEHFIRLLIKYEVTPISFFESLDAVMELEEKIEGIL |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 31841667 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2323104 | 2323400 | - | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 2 | 1235413 | 1235667 | + | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP036345.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01381.24 | 1.0 | 2 | 2994.5 | both-strands | Helix-turn-helix |
| 2 | PF13443.8 | 1.0 | 2 | 2755.0 | opposite-strand | Cro/C1-type HTH DNA-binding domain |
| 3 | PF00682.21 | 1.0 | 2 | 708.0 | opposite-strand | HMGL-like |
| 4 | PF08502.12 | 1.0 | 2 | 708.0 | opposite-strand | LeuA allosteric (dimerisation) domain |
| 5 | PF01205.21 | 1.0 | 2 | -9.5 | same-strand | Uncharacterized protein family UPF0029 |
| 6 | PF09186.13 | 1.0 | 2 | -9.5 | same-strand | Domain of unknown function (DUF1949) |
| 7 | PF00912.24 | 1.0 | 2 | 164.0 | opposite-strand | Transglycosylase |
| 8 | PF00905.24 | 1.0 | 2 | 164.0 | opposite-strand | Penicillin binding protein transpeptidase domain |
| 9 | PF03862.15 | 1.0 | 2 | 3549.0 | same-strand | SpoVAC/SpoVAEB sporulation membrane protein |
| 10 | PF07451.13 | 1.0 | 2 | 3219.5 | same-strand | Stage V sporulation protein AD (SpoVAD) |
++ More..