Result : B2KAU3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L28 |
| NCBI Accession ID | CP001055.1 |
| Organism | Elusimicrobium minutum (strain Pei191) |
| Left | 76398 |
| Right | 76592 |
| Strand | + |
| Nucleotide Sequence | ATGTCATACAAATGTCAATTATGTGGGAAAGGCTCCGTAACAGGCGGTTCTTACAGTCACTCACATAGAAATACAAAAAGAACTTTTAGACCAAACCTTCAAAAACAAAAAGTTGTTCTTGAGGGCAAAACACAAACTGCCTATGTCTGCACAAAATGCATCAAAAGCGGTTTTACAACAAAACCTGTCAAATAA |
| Sequence | MSYKCQLCGKGSVTGGSYSHSHRNTKRTFRPNLQKQKVVLEGKTQTAYVCTKCIKSGFTTKPVK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 19270133 |
| Domain | CDD:412338 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B2KAU3 |
| ORF Length (Amino Acid) | 64 |
++ More..
| Conservation Analysis |
No. of Species: 53
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 76398 | 76592 | + | NC_010644.1 | Elusimicrobium minutum Pei191 |
| 2 | 580664 | 580855 | - | NZ_CP009498.1 | Endomicrobium proavitum |
| 3 | 2506165 | 2506356 | + | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 4 | 1882902 | 1883093 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 5 | 4069275 | 4069466 | - | NZ_AP018449.1 | Methylomusa anaerophila |
| 6 | 1424631 | 1424822 | - | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 7 | 388766 | 388966 | + | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 8 | 1282007 | 1282195 | + | NZ_CP020921.1 | Thermodesulfobium acidiphilum |
| 9 | 1723106 | 1723303 | + | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 10 | 1758161 | 1758358 | + | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 11 | 1372361 | 1372549 | + | NC_015499.1 | Thermodesulfobium narugense DSM 14796 |
| 12 | 1590662 | 1590856 | + | NZ_CP062948.1 | Bifidobacterium lemurum |
| 13 | 1163415 | 1163606 | - | NZ_CP020953.1 | Clostridium drakei |
| 14 | 124579 | 124770 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 15 | 1285984 | 1286178 | - | NZ_CP062938.1 | Bifidobacterium eulemuris |
| 16 | 2009884 | 2010084 | - | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 17 | 870984 | 871172 | + | NZ_LT635455.1 | Olsenella timonensis |
| 18 | 390081 | 390275 | + | NZ_CP026999.1 | Bifidobacterium longum |
| 19 | 2631537 | 2631728 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 20 | 1226532 | 1226720 | + | NC_015389.1 | Coriobacterium glomerans PW2 |
| 21 | 3046959 | 3047150 | + | NZ_CP042430.1 | Baekduia soli |
| 22 | 2762051 | 2762266 | - | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 23 | 2055762 | 2055953 | - | NC_020520.1 | Ilumatobacter coccineus YM16-304 |
| 24 | 1055884 | 1056096 | - | NZ_CP007389.1 | Thermosipho melanesiensis |
| 25 | 1980973 | 1981167 | - | NZ_CP006712.1 | Bifidobacterium breve JCM 7017 |
| 26 | 958494 | 958682 | + | NC_013203.1 | Lancefieldella parvulum DSM 20469 |
| 27 | 1815415 | 1815627 | - | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 28 | 960815 | 960994 | - | NC_017096.1 | Caldisericum exile AZM16c01 |
| 29 | 721284 | 721496 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 30 | 243308 | 243502 | + | NZ_AP012325.1 | Bifidobacterium catenulatum DSM 16992 = JCM 1194 = LMG 11043 |
| 31 | 288471 | 288665 | + | NZ_CP025199.1 | Bifidobacterium pseudocatenulatum |
| 32 | 1846451 | 1846666 | + | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 33 | 276401 | 276595 | + | NZ_CP028341.1 | Bifidobacterium adolescentis |
| 34 | 3035497 | 3035709 | + | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 35 | 221672 | 221872 | - | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 36 | 2074614 | 2074811 | + | NC_014246.1 | Mobiluncus curtisii ATCC 43063 |
| 37 | 1323867 | 1324076 | - | NC_011653.1 | Thermosipho africanus TCF52B |
| 38 | 1346999 | 1347187 | + | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 39 | 1325187 | 1325375 | + | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 40 | 515443 | 515655 | - | NC_014963.1 | Terriglobus saanensis SP1PR4 |
| 41 | 446247 | 446441 | - | NC_012440.1 | Persephonella marina EX-H1 |
| 42 | 301482 | 301673 | - | NC_014330.1 | Brachyspira pilosicoli 95/1000 |
| 43 | 862305 | 862496 | - | NZ_AP019551.1 | Athalassotoga saccharophila |
| 44 | 2018129 | 2018320 | + | NC_010003.1 | Petrotoga mobilis SJ95 |
| 45 | 1011008 | 1011199 | - | NZ_CP011402.1 | Denitrobacterium detoxificans |
| 46 | 1004330 | 1004518 | + | NZ_AP019367.1 | Parolsenella catena |
| 47 | 2329441 | 2329632 | - | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 48 | 1422260 | 1422448 | + | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 49 | 716113 | 716304 | - | NZ_CP009302.1 | Berryella intestinalis |
| 50 | 1618180 | 1618371 | - | NC_013204.1 | Eggerthella lenta DSM 2243 |
| 51 | 1094020 | 1094211 | + | NC_022567.1 | Adlercreutzia equolifaciens DSM 19450 |
| 52 | 3539168 | 3539359 | - | NZ_CP047156.1 | Epidermidibacterium keratini |
| 53 | 1381423 | 1381617 | + | NZ_CP044548.2 | Janibacter melonis |
++ More..