Result : EXP01198
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01198 |
| NCBI Accession ID | AE015928.1 |
| Organism | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) |
| Left | 3345516 |
| Right | 3345809 |
| Strand | - |
| Nucleotide Sequence | ATGAAATCAGTATTGATAACATTCGATCAGGCGTATTACGAACGGATCATGGCATTGCTCGACCGTCTGAACTGCCGTGGCTTTACATACCTTGAAAAGGTGCAGGGACGTGGCTCAAAGACAGGCGATCCGCACTTCGGCAGCCATGCCTGGCCCAGTATGTGTTCGGCTATCCTTACGGTGGTCGATGACAATAAAGTCGATCCGTTGCTGGATACACTGCATAAGATGGACTTACAGACCGAACAGCTGGGATTACGTGCATTTGTATGGAATATTGAACGGACCATCTAG |
| Sequence | MKSVLITFDQAYYERIMALLDRLNCRGFTYLEKVQGRGSKTGDPHFGSHAWPSMCSAILTVVDDNKVDPLLDTLHKMDLQTEQLGLRAFVWNIERTI |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 31841667 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 18
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 648261 | 648554 | - | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 2 | 3379262 | 3379555 | - | NZ_CP012938.1 | Bacteroides ovatus |
| 3 | 3808600 | 3808893 | - | NZ_CP015401.2 | Bacteroides caecimuris |
| 4 | 4655624 | 4655917 | - | NZ_LN877293.1 | Bacteroides fragilis |
| 5 | 1387888 | 1388181 | + | NC_014933.1 | Bacteroides helcogenes P 36-108 |
| 6 | 2485539 | 2485832 | + | NZ_CP027231.1 | Bacteroides zoogleoformans |
| 7 | 1679873 | 1680166 | - | NZ_CP027234.1 | Bacteroides heparinolyticus |
| 8 | 354931 | 355224 | - | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
| 9 | 399890 | 400183 | - | NZ_LR699004.1 | Phocaeicola dorei |
| 10 | 3053526 | 3053819 | + | NZ_CP007034.1 | Barnesiella viscericola DSM 18177 |
| 11 | 747146 | 747439 | - | NZ_CP054012.1 | Parabacteroides distasonis |
| 12 | 2948864 | 2949157 | - | NZ_LT605205.1 | Proteiniphilum saccharofermentans |
| 13 | 2658619 | 2658912 | - | NZ_LT605205.1 | Proteiniphilum saccharofermentans |
| 14 | 485683 | 485976 | - | NZ_LS483447.1 | Porphyromonas crevioricanis |
| 15 | 2793888 | 2794181 | - | NZ_LT608328.1 | Petrimonas mucosa |
| 16 | 525248 | 525550 | + | NZ_LR134506.1 | Porphyromonas cangingivalis |
| 17 | 3269158 | 3269451 | - | NZ_AP019735.1 | Alistipes communis |
| 18 | 17492 | 17785 | - | NC_018011.1 | Alistipes finegoldii DSM 17242 |
| 19 | 1591072 | 1591311 | - | NC_010729.1 | Porphyromonas gingivalis ATCC 33277 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP040530.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00873.21 | 1.0 | 18 | 26.0 | same-strand | AcrB/AcrD/AcrF family |
| 2 | PF16576.7 | 1.0 | 18 | 3208 | same-strand | Barrel-sandwich domain of CusB or HlyD membrane-fusion |
| 3 | PF13437.8 | 1.0 | 18 | 3208 | same-strand | HlyD family secretion protein |
| 4 | PF13533.8 | 0.78 | 14 | 3247.5 | same-strand | Biotin-lipoyl like |
| 5 | PF02321.20 | 1.0 | 18 | 4268 | same-strand | Outer membrane efflux protein |
| 6 | PF00440.25 | 0.83 | 15 | 5702.0 | same-strand | Bacterial regulatory proteins, tetR family |
++ More..