ProsmORF-pred
Result : EXP01197
Protein Information
Information Type Description
Protein name EXP01197
NCBI Accession ID AE015928.1
Organism Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)
Left 5822437
Right 5822730
Strand -
Nucleotide Sequence ATGACAGAAGAAGAAAAAAAGTTATTGAGTACCTTTGAAACGCAGCTACGGCATTTAATGTATTTGCACGATGAATTAAAGCGTGAAAATGCCGGGTTGAGAAAACTTCTTGAAAACGAAAAGTTGAAGAACGAGAAGGTGCAAGCTCAGTATGATGAATTGGAAGTCAACTATACAAACCTAAAAACAGCTACGGCAATCAGCCTTAACGGCAGCGACGTAAAAGAGACGAAGCTGCGATTGTCAAAATTAGTGCGTGAAGTCGATAAATGCATCGCTTTATTGAACGAGTAA
Sequence MTEEEKKLLSTFETQLRHLMYLHDELKRENAGLRKLLENEKLKNEKVQAQYDELEVNYTNLKTATAISLNGSDVKETKLRLSKLVREVDKCIALLNE
Source of smORF Protein-level
Function
Pubmed ID 31841667
Domain
Functional Category Function not yet assigned
Uniprot ID
ORF Length (Amino Acid) 97
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 11
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 3123799 3124092 - NZ_CP040530.1 Bacteroides thetaiotaomicron
2 6076175 6076468 - NZ_CP012938.1 Bacteroides ovatus
3 879138 879431 - NZ_CP015401.2 Bacteroides caecimuris
4 155196 155489 - NZ_CP027231.1 Bacteroides zoogleoformans
5 456421 456714 - NZ_CP027234.1 Bacteroides heparinolyticus
6 1975670 1975963 - NC_014933.1 Bacteroides helcogenes P 36-108
7 3944292 3944585 - NZ_LN877293.1 Bacteroides fragilis
8 2694681 2694974 - NC_009614.1 Phocaeicola vulgatus ATCC 8482
9 2881496 2881789 - NZ_LR699004.1 Phocaeicola dorei
10 362496 362789 - NZ_CP069440.1 Phocaeicola coprophilus
11 3625978 3626271 + NC_015164.1 Phocaeicola salanitronis DSM 18170
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_CP040530.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF03932.16 0.64 7 2044 same-strand CutC family
2 PF12072.10 1.0 11 427 same-strand RNase Y N-terminal region
3 PF01966.24 1.0 11 427 same-strand HD domain
4 PF05164.15 1.0 11 15 same-strand Cell division protein ZapA
++ More..