Result : EXP01197
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01197 |
| NCBI Accession ID | AE015928.1 |
| Organism | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) |
| Left | 5822437 |
| Right | 5822730 |
| Strand | - |
| Nucleotide Sequence | ATGACAGAAGAAGAAAAAAAGTTATTGAGTACCTTTGAAACGCAGCTACGGCATTTAATGTATTTGCACGATGAATTAAAGCGTGAAAATGCCGGGTTGAGAAAACTTCTTGAAAACGAAAAGTTGAAGAACGAGAAGGTGCAAGCTCAGTATGATGAATTGGAAGTCAACTATACAAACCTAAAAACAGCTACGGCAATCAGCCTTAACGGCAGCGACGTAAAAGAGACGAAGCTGCGATTGTCAAAATTAGTGCGTGAAGTCGATAAATGCATCGCTTTATTGAACGAGTAA |
| Sequence | MTEEEKKLLSTFETQLRHLMYLHDELKRENAGLRKLLENEKLKNEKVQAQYDELEVNYTNLKTATAISLNGSDVKETKLRLSKLVREVDKCIALLNE |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 31841667 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3123799 | 3124092 | - | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 2 | 6076175 | 6076468 | - | NZ_CP012938.1 | Bacteroides ovatus |
| 3 | 879138 | 879431 | - | NZ_CP015401.2 | Bacteroides caecimuris |
| 4 | 155196 | 155489 | - | NZ_CP027231.1 | Bacteroides zoogleoformans |
| 5 | 456421 | 456714 | - | NZ_CP027234.1 | Bacteroides heparinolyticus |
| 6 | 1975670 | 1975963 | - | NC_014933.1 | Bacteroides helcogenes P 36-108 |
| 7 | 3944292 | 3944585 | - | NZ_LN877293.1 | Bacteroides fragilis |
| 8 | 2694681 | 2694974 | - | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
| 9 | 2881496 | 2881789 | - | NZ_LR699004.1 | Phocaeicola dorei |
| 10 | 362496 | 362789 | - | NZ_CP069440.1 | Phocaeicola coprophilus |
| 11 | 3625978 | 3626271 | + | NC_015164.1 | Phocaeicola salanitronis DSM 18170 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP040530.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03932.16 | 0.64 | 7 | 2044 | same-strand | CutC family |
| 2 | PF12072.10 | 1.0 | 11 | 427 | same-strand | RNase Y N-terminal region |
| 3 | PF01966.24 | 1.0 | 11 | 427 | same-strand | HD domain |
| 4 | PF05164.15 | 1.0 | 11 | 15 | same-strand | Cell division protein ZapA |
++ More..