Result : EXP01195
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01195 |
| NCBI Accession ID | AE015928.1 |
| Organism | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) |
| Left | 1113022 |
| Right | 1113312 |
| Strand | - |
| Nucleotide Sequence | ATGAGAACAATAACATTTAATGAACTTCGCAAGATTAAAGATTCATTGCCTAGCGGTAGCATGCATAGAATAGCAGACGAACTTGGTTTGCACGTAGATACAGTGCGCAACTTCTTCGGAGGCCATAATTTCAAGGAAGGAAAAAGTGTCGGAATACATCTTGAGCCTGGTCCGGATGGCGGGCTTGTAATGCTAGATGACACAACTGTTCTCGACCGGGCTCTAAAAATTTTAGATGAAATAAACATGAGTATGCAAAAAGAACAAGCTACCGAACCTATGCAAATTTAA |
| Sequence | MRTITFNELRKIKDSLPSGSMHRIADELGLHVDTVRNFFGGHNFKEGKSVGIHLEPGPDGGLVMLDDTTVLDRALKILDEINMSMQKEQATEPMQI |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 31841667 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 32
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4691118 | 4691408 | - | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 2 | 2007607 | 2007897 | + | NZ_CP015401.2 | Bacteroides caecimuris |
| 3 | 928123 | 928413 | + | NZ_CP012938.1 | Bacteroides ovatus |
| 4 | 2829632 | 2829916 | - | NZ_LN877293.1 | Bacteroides fragilis |
| 5 | 1066226 | 1066501 | - | NZ_CP027234.1 | Bacteroides heparinolyticus |
| 6 | 445153 | 445428 | - | NZ_CP027231.1 | Bacteroides zoogleoformans |
| 7 | 2786942 | 2787214 | + | NC_014933.1 | Bacteroides helcogenes P 36-108 |
| 8 | 1405655 | 1405909 | + | NZ_CP069440.1 | Phocaeicola coprophilus |
| 9 | 4533641 | 4533910 | + | NZ_LR699004.1 | Phocaeicola dorei |
| 10 | 4125503 | 4125772 | + | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
| 11 | 630818 | 631075 | + | NC_015164.1 | Phocaeicola salanitronis DSM 18170 |
| 12 | 1440244 | 1440516 | + | NZ_CP054012.1 | Parabacteroides distasonis |
| 13 | 380456 | 380710 | - | NC_010729.1 | Porphyromonas gingivalis ATCC 33277 |
| 14 | 9112 | 9372 | - | NZ_LT608328.1 | Petrimonas mucosa |
| 15 | 146968 | 147222 | - | NC_014734.1 | Paludibacter propionicigenes WB4 |
| 16 | 4214286 | 4214576 | + | NZ_LT605205.1 | Proteiniphilum saccharofermentans |
| 17 | 1717940 | 1718197 | + | NZ_LR134506.1 | Porphyromonas cangingivalis |
| 18 | 180367 | 180627 | + | NZ_CP007034.1 | Barnesiella viscericola DSM 18177 |
| 19 | 1841899 | 1842159 | + | NZ_CP041345.1 | Tenuifilum thalassicum |
| 20 | 70023 | 70283 | + | NZ_CP015402.2 | Muribaculum intestinale |
| 21 | 1588962 | 1589213 | - | NZ_LS483447.1 | Porphyromonas crevioricanis |
| 22 | 2376514 | 2376756 | - | NZ_AP019735.1 | Alistipes communis |
| 23 | 3262952 | 3263206 | + | NZ_CP045696.1 | Sodaliphilus pleomorphus |
| 24 | 3185873 | 3186118 | - | NZ_LR027382.1 | Alistipes megaguti |
| 25 | 2385976 | 2386218 | + | NZ_AP019736.1 | Alistipes dispar |
| 26 | 1866124 | 1866384 | + | NC_015501.1 | Porphyromonas asaccharolytica DSM 20707 |
| 27 | 1358107 | 1358358 | + | NZ_AP018042.1 | Labilibaculum antarcticum |
| 28 | 2518740 | 2518988 | - | NZ_CP069450.1 | Butyricimonas virosa |
| 29 | 3213271 | 3213513 | + | NC_018011.1 | Alistipes finegoldii DSM 17242 |
| 30 | 1284984 | 1285232 | + | NZ_CP032819.1 | Butyricimonas faecalis |
| 31 | 2054518 | 2054778 | + | NZ_AP023049.1 | Alistipes indistinctus |
| 32 | 7372116 | 7372361 | - | NC_015510.1 | Haliscomenobacter hydrossis DSM 1100 |
++ More..