Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01193 |
NCBI Accession ID | CP036346.1 |
Organism | Erysipelatoclostridium ramosum DSM 1402 |
Left | 1506639 |
Right | 1506929 |
Strand | + |
Nucleotide Sequence | ATGACTGCAATTGATGTTTGTTACTGTGTTTTAATACTTTCTGGAGCATTTGCCTTAGTTAGCTTAGGAATTTTATTGCTTCGTAGTTCAACCACAGTTAAACAAGTGGGGAACACAGTCGAAATGGCTCAAAGCACAATTAATAAAGCGGATAAAATTATGGATGATATAACTTACAAGTTAGATCTTTTGAATGCGCCAGTAGAAACAATCGCGCGTTTCTTTGATCCAAATCGACCTAAGTTTAATCCTATAAGTGCTATTATTGGATTGTTCAAAAAGAAATTTTAG |
Sequence | MTAIDVCYCVLILSGAFALVSLGILLLRSSTTVKQVGNTVEMAQSTINKADKIMDDITYKLDLLNAPVETIARFFDPNRPKFNPISAIIGLFKKKF |
Source of smORF | Protein-level |
Function | The ORF matches to the profile of cl01972. Profile Description: Bacterial protein of unknown function (DUF948). This family consists of bacterial sequences several of which are thought to be general stress proteins. |
Pubmed ID | 31841667 |
Domain | CDD:413138 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 96 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1210495 | 1210785 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
2 | 1532048 | 1532335 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00579.27 | 1.0 | 2 | 2572.0 | same-strand | tRNA synthetases class I (W and Y) |
2 | PF00356.23 | 1.0 | 2 | 491.5 | same-strand | Bacterial regulatory proteins, lacI family |
3 | PF13377.8 | 1.0 | 2 | 491.5 | same-strand | Periplasmic binding protein-like domain |
4 | PF00532.23 | 1.0 | 2 | 491.5 | same-strand | Periplasmic binding proteins and sugar binding domain of LacI family |
5 | PF13407.8 | 1.0 | 2 | 491.5 | same-strand | Periplasmic binding protein domain |
6 | PF12732.9 | 1.0 | 2 | 15.5 | same-strand | YtxH-like protein |
7 | PF08245.14 | 1.0 | 2 | 48.5 | same-strand | Mur ligase middle domain |
8 | PF01225.27 | 1.0 | 2 | 48.5 | same-strand | Mur ligase family, catalytic domain |
9 | PF02875.23 | 1.0 | 2 | 48.5 | same-strand | Mur ligase family, glutamate ligase domain |
10 | PF00557.26 | 1.0 | 2 | 1715.5 | same-strand | Metallopeptidase family M24 |
11 | PF01321.20 | 1.0 | 2 | 1715.5 | same-strand | Creatinase/Prolidase N-terminal domain |
12 | PF00152.22 | 1.0 | 2 | 2775.5 | same-strand | tRNA synthetases class II (D, K and N) |
13 | PF02938.16 | 1.0 | 2 | 2775.5 | same-strand | GAD domain |
14 | PF01336.27 | 1.0 | 2 | 2775.5 | same-strand | OB-fold nucleic acid binding domain |
15 | PF13393.8 | 1.0 | 2 | 4522.5 | same-strand | Histidyl-tRNA synthetase |
16 | PF03129.22 | 1.0 | 2 | 4522.5 | same-strand | Anticodon binding domain |
17 | PF00587.27 | 1.0 | 2 | 4522.5 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |