Result : EXP01192
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01192 |
| NCBI Accession ID | ABAX03000010.1 |
| Organism | Anaerostipes caccae (strain DSM 14662 / NCIMB 13811 / L1-92) |
| Left | 42356 |
| Right | 42646 |
| Strand | - |
| Nucleotide Sequence | ATGCCAAAGGATTTATTTGATAAGATCGAGCAGACCATAACGACTACTGGGAAAGCGGCGGCGAAAAAAGCAAGGGAAGTAGCGGATACGGCAAAGATTAAAAATGACATCCGAGTTGCAAAGCGTGAATTAAATGATTTGTATGAGCAGGTTGGACGGCAGTATTTTGAGTCTCATATGGATTATCCGGAAGCGGAATATATTGATCTGTTTAATCTGATCGAAAAGATCCGGGGAGATATCAAAGTCATGGAAGCAGACCTTGAGATGGTCAGAGAAGAAGAATCGTAA |
| Sequence | MPKDLFDKIEQTITTTGKAAAKKAREVADTAKIKNDIRVAKRELNDLYEQVGRQYFESHMDYPEAEYIDLFNLIEKIRGDIKVMEADLEMVREEES |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 31841667 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2605937 | 2606227 | - | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 2 | 924216 | 924503 | + | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP036345.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00069.27 | 1.0 | 2 | 2812.5 | same-strand | Protein kinase domain |
| 2 | PF13672.8 | 1.0 | 2 | 2061.5 | same-strand | Protein phosphatase 2C |
| 3 | PF00392.23 | 1.0 | 2 | 1561.5 | opposite-strand | Bacterial regulatory proteins, gntR family |
| 4 | PF00005.29 | 1.0 | 2 | 845.5 | opposite-strand | ABC transporter |
| 5 | PF14821.8 | 1.0 | 2 | 1417.5 | same-strand | Threonine synthase N terminus |
| 6 | PF00291.27 | 1.0 | 2 | 1417.5 | same-strand | Pyridoxal-phosphate dependent enzyme |
| 7 | PF01546.30 | 1.0 | 2 | 3060.5 | same-strand | Peptidase family M20/M25/M40 |
| 8 | PF07687.16 | 1.0 | 2 | 3060.5 | same-strand | Peptidase dimerisation domain |
++ More..