Result : EXP01190
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01190 |
| NCBI Accession ID | AE015928.1 |
| Organism | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) |
| Left | 5774251 |
| Right | 5774538 |
| Strand | - |
| Nucleotide Sequence | ATGGGTGGCGAAGGACATATGCTCGACATGATACGTCGGCTGAAAGACGGCAAAGAAGCCTCCCGCTTACGCCGTGAACGGAGAAATGACAAGTTAGGGCGACTTAGAAGAAACAACGACCCTTATCTTCTGCCGGATACGACTCCGGAAGAGATGGAACGCATCATCAAGGATTCGGAAAAGAAAAAAGAAAAAGATAACAGCTATTTCGTATGGGGAACGCTTATCATTATGGGCGTACTGATAGGATGTGCTGTCCTCCTGTGGGCAATCTTTTTTAATGGATAA |
| Sequence | MGGEGHMLDMIRRLKDGKEASRLRRERRNDKLGRLRRNNDPYLLPDTTPEEMERIIKDSEKKKEKDNSYFVWGTLIIMGVLIGCAVLLWAIFFNG |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 31841667 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3075613 | 3075900 | - | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 2 | 858017 | 858301 | - | NZ_CP015401.2 | Bacteroides caecimuris |
| 3 | 6039853 | 6040137 | - | NZ_CP012938.1 | Bacteroides ovatus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP040530.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04390.14 | 1.0 | 3 | 3272 | opposite-strand | Lipopolysaccharide-assembly |
| 2 | PF03840.16 | 1.0 | 3 | 2139 | opposite-strand | Preprotein translocase SecG subunit |
| 3 | PF07690.18 | 1.0 | 3 | 631 | opposite-strand | Major Facilitator Superfamily |
| 4 | PF05402.14 | 1.0 | 3 | 15 | opposite-strand | Coenzyme PQQ synthesis protein D (PqqD) |
| 5 | PF16115.7 | 1.0 | 3 | 37 | same-strand | Domain of unknown function (DUF4831) |
| 6 | PF01256.19 | 1.0 | 3 | 1177 | same-strand | Carbohydrate kinase |
| 7 | PF03853.17 | 1.0 | 3 | 1177 | same-strand | YjeF-related protein N-terminus |
| 8 | PF10771.11 | 0.67 | 2 | 3542.0 | opposite-strand | Winged helix-turn-helix domain (DUF2582) |
| 9 | PF00156.29 | 1.0 | 3 | 5337 | opposite-strand | Phosphoribosyl transferase domain |
++ More..