Result : EXP01189
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01189 |
| NCBI Accession ID | ABAX03000014.1 |
| Organism | Anaerostipes caccae (strain DSM 14662 / NCIMB 13811 / L1-92) |
| Left | 193531 |
| Right | 193818 |
| Strand | - |
| Nucleotide Sequence | ATGATAGGGCTATCAAAAAGCAGAGGAGCGTTGAGCATGGAAAACCAGAAAATGCCGGAATATGAAACCATACGCGCCGCCGTTGCCGGGGAGAAATGGGCGGTGGAGAAAGTCGTGGATTGCTACAAGGACGAAATCGACAGGCTATCGACGGTAGCGGTCAGACAGCCAGACGGAAGCACGAAACAGGAAATCAACGAAGATATGCGCCAGTCTATCACAAAGAAGCTGATAGAAGCCCTCCCGCAGTTCCCGCTTGAAGAAATGGAAAAGGGAAATGTCAGATAG |
| Sequence | MIGLSKSRGALSMENQKMPEYETIRAAVAGEKWAVEKVVDCYKDEIDRLSTVAVRQPDGSTKQEINEDMRQSITKKLIEALPQFPLEEMEKGNVR |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of pfam12645. Profile Description: Helix-turn-helix domain. This domain appears to be a helix-turn-helix domain suggesting that this might be a transcriptional regulatory protein. Some members of this family are annotated as conjugative transposon domains. |
| Pubmed ID | 31841667 |
| Domain | CDD:403747 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3293209 | 3293496 | - | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 2 | 501880 | 502167 | - | NZ_CP029487.1 | Eubacterium maltosivorans |
| 3 | 4200168 | 4200437 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 4 | 1118695 | 1118982 | - | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 5 | 2629869 | 2630156 | - | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 6 | 4713483 | 4713770 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 7 | 1878897 | 1879133 | + | NZ_CP030777.1 | Faecalibacterium prausnitzii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR027880.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01131.22 | 0.83 | 5 | 5401.0 | opposite-strand | DNA topoisomerase |
| 2 | PF01751.24 | 0.67 | 4 | 5482 | opposite-strand | Toprim domain |
| 3 | PF14191.8 | 1.0 | 6 | 1706 | opposite-strand | YodL-like |
| 4 | PF07275.13 | 1.0 | 6 | 1706 | opposite-strand | Antirestriction protein (ArdA) |
| 5 | PF08401.13 | 1.0 | 6 | 1706 | opposite-strand | N-terminal domain of anti-restriction factor ArdC |
| 6 | PF14195.8 | 1.0 | 6 | 1706 | opposite-strand | Domain of unknown function (DUF4316) |
| 7 | PF14203.8 | 1.0 | 6 | 540 | opposite-strand | Putative transposon-transfer assisting protein |
| 8 | PF14194.8 | 1.0 | 6 | 178 | opposite-strand | Cysteine-rich VLP |
| 9 | PF03432.16 | 0.83 | 5 | 28.0 | same-strand | Relaxase/Mobilisation nuclease domain |
| 10 | PF05713.13 | 1.0 | 6 | 1335 | same-strand | Bacterial mobilisation protein (MobC) |
| 11 | PF18430.3 | 1.0 | 6 | 1932 | same-strand | Putative DNA-binding domain |
| 12 | PF01381.24 | 1.0 | 6 | 1932 | same-strand | Helix-turn-helix |
| 13 | PF12844.9 | 1.0 | 6 | 1932 | same-strand | Helix-turn-helix domain |
| 14 | PF14205.8 | 0.67 | 4 | 2665.5 | opposite-strand | Cysteine-rich KTR |
| 15 | PF04055.23 | 0.83 | 5 | 2873 | opposite-strand | Radical SAM superfamily |
| 16 | PF18828.3 | 0.83 | 5 | 1706 | opposite-strand | Large polyvalent-protein-associated domain 15 |
++ More..