Result : EXP01187
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01187 |
| NCBI Accession ID | AE015928.1 |
| Organism | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) |
| Left | 1760189 |
| Right | 1760464 |
| Strand | + |
| Nucleotide Sequence | ATGATCAGATTAAATGTTTTTGTTCGTGTAAACGAAACAAACCGCGAAAAAGCGATTGAGGCAGCAAAAGAACTGACTGCCTGCTCTTTGAAAGAAGAAGGATGCATTGCTTACGATACTTTTGAAAGCAGTACCCGCCGTGATGTTTTCATGATTTGCGAAACATGGCAGAATGCTGAAGTATTGGCAGCACACGAAAAAACCGCTCATTTTGCACAATACGTAGGTATCATTCAGGAATTAGCTGAAATGAAACTGGAAAAGTTTGAATTCTAA |
| Sequence | MIRLNVFVRVNETNREKAIEAAKELTACSLKEEGCIAYDTFESSTRRDVFMICETWQNAEVLAAHEKTAHFAQYVGIIQELAEMKLEKFEF |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl10022. Profile Description: Antibiotic biosynthesis monooxygenase. The function of this family is unknown, but it is upregulated in response to salt stress in Populus balsamifera. It is also found at the C-terminus of an fructose 1,6-bisphosphate aldolase from Hydrogenophilus thermoluteolus. Arthrobacter nicotinovorans ORF106 is found in the pA01 plasmid, which encodes genes for molybdopterin uptake and degradation of plant alkaloid nicotine. The structure of one has been solved and the domain forms an a/b barrel dimer. Although there is a clear duplication within the domain it is not obviously detectable in the sequence. |
| Pubmed ID | 31841667 |
| Domain | CDD:415830 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5338318 | 5338593 | + | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 2 | 1768743 | 1769018 | + | NZ_CP012938.1 | Bacteroides ovatus |
| 3 | 4762354 | 4762629 | + | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
| 4 | 5062332 | 5062607 | + | NZ_LR699004.1 | Phocaeicola dorei |
| 5 | 3790220 | 3790495 | - | NC_014933.1 | Bacteroides helcogenes P 36-108 |
| 6 | 255380 | 255655 | + | NZ_AP019736.1 | Alistipes dispar |
| 7 | 2145019 | 2145294 | + | NZ_AP019735.1 | Alistipes communis |
| 8 | 3195425 | 3195700 | + | NZ_LR027382.1 | Alistipes megaguti |
| 9 | 1655830 | 1656105 | - | NZ_CP054012.1 | Parabacteroides distasonis |
| 10 | 3033777 | 3034052 | + | NC_018011.1 | Alistipes finegoldii DSM 17242 |
| 11 | 1071832 | 1072107 | + | NZ_CP069440.1 | Phocaeicola coprophilus |
| 12 | 37859 | 38134 | + | NC_014734.1 | Paludibacter propionicigenes WB4 |
++ More..