Result : EXP01186
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01186 |
| NCBI Accession ID | ACOM01000005.1 |
| Organism | Clostridium butyricum E4 str. BoNT E BL5262 |
| Left | 2125149 |
| Right | 2125424 |
| Strand | - |
| Nucleotide Sequence | ATGAGACAATGTATGGATTCTGAAAATCTTCATAGAAGATTAAAGAAAATAATTGGTCAGGTACAAGCAATTGATAGAATGATAGATGATGATGTTCCGTGTGAAGATGTTTTGTCACAAATTAATGCAGCTAAATCAGCTCTTCATAAGGCAGGGCAAGTTGTCTTAGAGGGACATATTAAACATTGCGTACGTGATGGAATAGAACATGGTGATGCTGATAAAACAATTGATAGTTTCACTAAAGCTGTTGAACGTTTTGCAAATATGAGTTAA |
| Sequence | MRQCMDSENLHRRLKKIIGQVQAIDRMIDDDVPCEDVLSQINAAKSALHKAGQVVLEGHIKHCVRDGIEHGDADKTIDSFTKAVERFANMS |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl00846. Profile Description: Transcriptional regulators CsoR (copper-sensitive operon repressor), RcnR, and FrmR, and related domains; this domain superfamily was previously known as DUF156. This is a family of metal-sensitive repressors, involved in resistance to metal ions. Members of this family bind copper, nickel or cobalt ions via conserved cysteine and histidine residues. In the absence of metal ions, these proteins bind to promoter regions and repress transcription. When bound to metal ions they are unable to bind DNA, leading to transcriptional derepression. |
| Pubmed ID | 31841667 |
| Domain | CDD:412603 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 48
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 830720 | 830995 | + | NZ_CP030775.1 | Clostridium butyricum |
| 2 | 2706958 | 2707233 | + | NC_013204.1 | Eggerthella lenta DSM 2243 |
| 3 | 3143896 | 3144171 | - | NZ_CP020953.1 | Clostridium drakei |
| 4 | 1033320 | 1033595 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 5 | 1169309 | 1169584 | - | NZ_CP068055.1 | Sutterella wadsworthensis |
| 6 | 1205477 | 1205752 | + | NZ_CP048649.1 | Aminipila butyrica |
| 7 | 2085730 | 2086005 | + | NZ_CP034413.2 | Dysosmobacter welbionis |
| 8 | 1764421 | 1764699 | + | NZ_LR134375.1 | Veillonella dispar |
| 9 | 1497174 | 1497449 | - | NZ_CP039126.1 | Blautia producta |
| 10 | 1799098 | 1799373 | + | NZ_LT990039.1 | Massilistercora timonensis |
| 11 | 1731137 | 1731415 | + | NZ_AP022321.1 | Veillonella nakazawae |
| 12 | 1821791 | 1822069 | + | NZ_LR778174.1 | Veillonella parvula |
| 13 | 2334593 | 2334868 | + | NZ_CP029462.1 | Megasphaera stantonii |
| 14 | 2412898 | 2413173 | + | NZ_AP021898.1 | Akkermansia muciniphila |
| 15 | 1767472 | 1767750 | + | NZ_LT906470.1 | Veillonella rodentium |
| 16 | 2387271 | 2387546 | - | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 17 | 1765942 | 1766217 | + | NZ_CP040882.1 | Sutterella faecalis |
| 18 | 623981 | 624256 | + | NZ_CP048436.1 | Flavonifractor plautii |
| 19 | 3334326 | 3334601 | - | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 20 | 2722319 | 2722594 | - | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 21 | 103891 | 104166 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 22 | 788276 | 788551 | + | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 23 | 1465314 | 1465589 | - | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 24 | 132849 | 133121 | + | NZ_CP028105.1 | Fusobacterium ulcerans |
| 25 | 822752 | 823024 | - | NZ_AP019779.1 | Methanobrevibacter arboriphilus |
| 26 | 1622092 | 1622370 | + | NZ_LT906446.1 | Megamonas hypermegale |
| 27 | 2679935 | 2680210 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 28 | 317512 | 317787 | - | NZ_CP016757.1 | Cloacibacillus porcorum |
| 29 | 3480186 | 3480461 | + | NZ_CP043998.1 | Clostridium diolis |
| 30 | 2385822 | 2386097 | - | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 31 | 1658506 | 1658781 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 32 | 5709762 | 5710037 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 33 | 734044 | 734319 | + | NZ_CP035108.1 | Geovibrio thiophilus |
| 34 | 1196070 | 1196345 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 35 | 3672256 | 3672531 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 36 | 2260418 | 2260693 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 37 | 1588593 | 1588865 | - | NZ_CP014265.1 | Methanobrevibacter olleyae |
| 38 | 1349737 | 1350012 | + | NZ_CP028106.1 | Fusobacterium gonidiaformans ATCC 25563 |
| 39 | 1783863 | 1784138 | + | NZ_CP028107.1 | Fusobacterium necrophorum subsp. funduliforme |
| 40 | 921849 | 922121 | + | NC_009515.1 | Methanobrevibacter smithii ATCC 35061 |
| 41 | 1143870 | 1144142 | - | NZ_LR698975.1 | Methanosphaera stadtmanae |
| 42 | 2396735 | 2397007 | - | NC_013790.1 | Methanobrevibacter ruminantium M1 |
| 43 | 549519 | 549782 | + | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 44 | 420418 | 420690 | - | NZ_AP018676.1 | Helicobacter cinaedi |
| 45 | 3719445 | 3719720 | - | NC_014624.2 | Eubacterium callanderi |
| 46 | 2130112 | 2130387 | - | NZ_CP029487.1 | Eubacterium maltosivorans |
| 47 | 1447699 | 1447974 | + | NZ_CP019962.1 | Eubacterium limosum |
| 48 | 481107 | 481343 | - | NZ_LN907858.1 | Helicobacter typhlonius |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP030775.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00122.22 | 0.67 | 32 | 130 | same-strand | E1-E2 ATPase |
| 2 | PF00702.28 | 0.67 | 32 | 130 | same-strand | haloacid dehalogenase-like hydrolase |
++ More..