Result : EXP01183
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01183 |
| NCBI Accession ID | AE015928.1 |
| Organism | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) |
| Left | 291941 |
| Right | 292210 |
| Strand | - |
| Nucleotide Sequence | ATGGCAAGTAGAAGAGAACTTAAAAAGAACGTAAACTATATCGCAGGAGAATTATTCACCGAGTGCTTAATCAATAGTATGTTTATCCCTGGTACTGACAAGGCTAAAGCTGATGAACTGATGGCTGAAGTTTTAAGAATGCAGGATGAATTTGTCAGCCGCATCAGCCATACAGAGCCGGGCAATGTGAAAGGCTTTTATAAGAAATTCCGAGTAGATTTCAATGCAAAAGTTAACGAGATTATTGAGGCCATCGGGAAATTGAATTAA |
| Sequence | MASRRELKKNVNYIAGELFTECLINSMFIPGTDKAKADELMAEVLRMQDEFVSRISHTEPGNVKGFYKKFRVDFNAKVNEIIEAIGKLN |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 31841667 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3870037 | 3870306 | - | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 2 | 187042 | 187311 | - | NZ_CP012938.1 | Bacteroides ovatus |
| 3 | 1530430 | 1530699 | - | NZ_CP015401.2 | Bacteroides caecimuris |
| 4 | 3357484 | 3357753 | + | NZ_LN877293.1 | Bacteroides fragilis |
| 5 | 1214116 | 1214385 | + | NZ_CP027234.1 | Bacteroides heparinolyticus |
| 6 | 3438827 | 3439096 | + | NC_014933.1 | Bacteroides helcogenes P 36-108 |
| 7 | 2640758 | 2641027 | - | NZ_CP027231.1 | Bacteroides zoogleoformans |
| 8 | 796472 | 796741 | - | NZ_LR215980.1 | Paraprevotella xylaniphila YIT 11841 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP040530.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01182.22 | 0.75 | 6 | 2266.0 | same-strand | Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase |
| 2 | PF02585.19 | 0.75 | 6 | 2266.0 | same-strand | GlcNAc-PI de-N-acetylase |
| 3 | PF00795.24 | 0.88 | 7 | 600 | same-strand | Carbon-nitrogen hydrolase |
| 4 | PF01553.23 | 1.0 | 8 | 3.5 | same-strand | Acyltransferase |
++ More..