Result : EXP01182
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01182 |
| NCBI Accession ID | ABFX02000008.1 |
| Organism | Erysipelatoclostridium ramosum DSM 1402 |
| Left | 430995 |
| Right | 431261 |
| Strand | + |
| Nucleotide Sequence | GTGATTAAATTGCGAAAAATCCCTTTAAGAAAATGTTTAGCAACGGGTGAACAGTTGCCAAAACAACAATTAATCAGAATCGTACGTAATAAAGAAGGTCAAGTAGCTGTCGATCCAACTGGTAAGATGAATGGACGAGGAGCTTATCTGAAACGTAGTCATGAAGCGTTCGTGTTAGCAAAAAAGAAAAAAGTTTTAGCTCGGGCTTTGCAGGTTGAAATTCCTGAAGAAATTTTCGTAGAACTGGAAAAATTTGCGGATGAATAA |
| Sequence | VIKLRKIPLRKCLATGEQLPKQQLIRIVRNKEGQVAVDPTGKMNGRGAYLKRSHEAFVLAKKKKVLARALQVEIPEEIFVELEKFADE |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl00189. Profile Description: N/A. Ylxr homologs; group of conserved hypothetical bacterial proteins of unknown function; structure revealed putative RNA binding cleft; proteins are encoded by an operon that includes other proteins involved in transcription and/or translation |
| Pubmed ID | 31841667 |
| Domain | CDD:412207 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | P32728 |
| ORF Length (Amino Acid) | 88 |
++ More..
| Conservation Analysis |
No. of Species: 130
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1157462 | 1157728 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 2 | 1469873 | 1470130 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 3 | 1709597 | 1709851 | - | NZ_AP019309.1 | Intestinibaculum porci |
| 4 | 84812 | 85084 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 5 | 2027986 | 2028258 | + | NZ_CP053187.1 | Turicibacter sanguinis |
| 6 | 574490 | 574750 | + | NZ_AP019711.1 | Amedibacterium intestinale |
| 7 | 1733847 | 1734080 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 8 | 2353549 | 2353776 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 9 | 2066467 | 2066694 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 10 | 2169383 | 2169610 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 11 | 1416362 | 1416586 | + | NZ_CP012024.1 | Bacillus smithii |
| 12 | 3049614 | 3049841 | + | NZ_CP013661.2 | Planococcus kocurii |
| 13 | 2213973 | 2214200 | - | NZ_CP019401.1 | Planococcus faecalis |
| 14 | 2079779 | 2080006 | - | NZ_CP016540.2 | Planococcus versutus |
| 15 | 1606831 | 1607106 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 16 | 1964116 | 1964346 | - | NZ_CP059540.1 | Planococcus maritimus |
| 17 | 2536597 | 2536824 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 18 | 1940523 | 1940753 | - | NZ_CP016538.2 | Planococcus maritimus |
| 19 | 1869071 | 1869292 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 20 | 1868169 | 1868393 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 21 | 1491497 | 1491778 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 22 | 3676542 | 3676769 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 23 | 4900135 | 4900359 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 24 | 1846426 | 1846650 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 25 | 2608594 | 2608818 | - | NZ_LS483476.1 | Lederbergia lentus |
| 26 | 1695324 | 1695554 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 27 | 1701202 | 1701477 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 28 | 2013684 | 2013911 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 29 | 1917949 | 1918179 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 30 | 2132583 | 2132816 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 31 | 591704 | 591976 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 32 | 986974 | 987270 | + | NZ_CP016953.1 | Streptococcus himalayensis |
| 33 | 1641061 | 1641336 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 34 | 581882 | 582154 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 35 | 58661 | 58894 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 36 | 1733410 | 1733685 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 37 | 3337402 | 3337686 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 38 | 1737550 | 1737825 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 39 | 1706260 | 1706535 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 40 | 252450 | 252725 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 41 | 1589995 | 1590291 | - | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 42 | 384915 | 385160 | + | NZ_LR134512.1 | Streptococcus agalactiae |
| 43 | 1641589 | 1641822 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 44 | 3666776 | 3667009 | - | NZ_CP043404.1 | Bacillus safensis |
| 45 | 371561 | 371857 | + | NZ_CP039457.1 | Streptococcus pasteurianus |
| 46 | 1157939 | 1158235 | + | NZ_CP054015.1 | Streptococcus gallolyticus |
| 47 | 2729333 | 2729572 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 48 | 202657 | 202899 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 49 | 2272831 | 2273106 | - | NZ_CP011937.1 | Bacillus velezensis |
| 50 | 1688027 | 1688302 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 51 | 2506834 | 2507058 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 52 | 2234957 | 2235241 | + | NZ_CP053989.1 | Niallia circulans |
| 53 | 1911749 | 1912024 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 54 | 1228118 | 1228414 | - | NZ_CP013237.1 | Streptococcus mutans |
| 55 | 1861124 | 1861369 | - | NZ_CP029491.1 | Streptococcus sobrinus |
| 56 | 679198 | 679437 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 57 | 1704291 | 1704587 | - | NZ_AP014612.1 | Streptococcus troglodytae |
| 58 | 1019193 | 1019489 | + | NZ_LR134293.1 | Streptococcus canis |
| 59 | 129042 | 129338 | - | NZ_CP032620.1 | Streptococcus koreensis |
| 60 | 1098987 | 1099226 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 61 | 2478551 | 2478778 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 62 | 1727599 | 1727826 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 63 | 3929342 | 3929572 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 64 | 2305939 | 2306172 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 65 | 1748625 | 1748882 | - | NC_012924.1 | Streptococcus suis SC84 |
| 66 | 337071 | 337367 | - | NZ_CP015196.1 | Streptococcus marmotae |
| 67 | 1615524 | 1615751 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 68 | 1277860 | 1278099 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 69 | 363716 | 363955 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 70 | 2704977 | 2705216 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 71 | 725699 | 725938 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 72 | 1635503 | 1635784 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 73 | 4297836 | 4298060 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 74 | 895430 | 895654 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 75 | 1314784 | 1315062 | + | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 76 | 2279404 | 2279676 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 77 | 1087415 | 1087711 | + | NZ_CP043405.1 | Streptococcus ratti |
| 78 | 1795310 | 1795570 | - | NZ_LT906439.1 | Streptococcus merionis |
| 79 | 2092392 | 2092631 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 80 | 976377 | 976676 | + | NZ_CP014164.1 | Aerococcus viridans |
| 81 | 1403744 | 1404037 | - | NZ_CP032621.1 | Streptococcus gwangjuense |
| 82 | 1697559 | 1697813 | - | NZ_CP060715.1 | Erysipelothrix inopinata |
| 83 | 458764 | 459009 | + | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 84 | 1532434 | 1532661 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 85 | 1817700 | 1817927 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 86 | 1072599 | 1072853 | + | NZ_CP011391.1 | Faecalibaculum rodentium |
| 87 | 1688550 | 1688843 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 88 | 1726217 | 1726474 | - | NZ_AP018400.1 | Streptococcus ruminantium |
| 89 | 716862 | 717158 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 90 | 1335652 | 1335924 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 91 | 1554042 | 1554335 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 92 | 1640430 | 1640699 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 93 | 574602 | 574847 | + | NZ_LR594049.1 | Streptococcus gordonii |
| 94 | 1177046 | 1177270 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 95 | 1830289 | 1830570 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 96 | 1851694 | 1851975 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 97 | 1486911 | 1487189 | - | NZ_CP034118.1 | Staphylospora marina |
| 98 | 262117 | 262413 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 99 | 1203062 | 1203277 | + | NZ_CP035130.1 | Gudongella oleilytica |
| 100 | 1753516 | 1753743 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 101 | 1210524 | 1210823 | - | NZ_CP013988.1 | Aerococcus urinaeequi |
| 102 | 3470849 | 3471124 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 103 | 1389796 | 1390017 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 104 | 2035659 | 2035940 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 105 | 3091519 | 3091746 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 106 | 6095178 | 6095486 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 107 | 4162490 | 4162798 | - | NZ_CP009287.1 | Paenibacillus graminis |
| 108 | 4883266 | 4883523 | - | NZ_CP009285.1 | Paenibacillus borealis |
| 109 | 1118177 | 1118404 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 110 | 3554787 | 3555014 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 111 | 1549442 | 1549663 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 112 | 2318366 | 2318638 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 113 | 2386159 | 2386383 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 114 | 1503075 | 1503302 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 115 | 1750854 | 1751147 | + | NZ_CP023011.2 | Enterococcus hirae |
| 116 | 2072242 | 2072466 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 117 | 2513341 | 2513571 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 118 | 1662820 | 1663086 | - | NZ_CP014204.2 | Clostridium baratii |
| 119 | 2069054 | 2069326 | - | NZ_CP009687.1 | Clostridium aceticum |
| 120 | 327686 | 327922 | + | NC_010163.1 | Acholeplasma laidlawii PG-8A |
| 121 | 1721347 | 1721565 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 122 | 708516 | 708752 | - | NZ_LR215050.1 | Acholeplasma hippikon |
| 123 | 1249643 | 1249939 | + | NZ_AP022822.1 | Enterococcus saigonensis |
| 124 | 984081 | 984344 | + | NZ_LN879430.1 | Herbinix luporum |
| 125 | 3085439 | 3085708 | - | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 126 | 1325909 | 1326178 | - | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 127 | 1156809 | 1157096 | + | NZ_CP046314.1 | Gemella morbillorum |
| 128 | 1951394 | 1951612 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 129 | 379269 | 379565 | + | NZ_LS483343.1 | Streptococcus ferus |
| 130 | 2162574 | 2162843 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 131 | 908602 | 908880 | - | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP023704.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02033.20 | 1.0 | 130 | 2806 | same-strand | Ribosome-binding factor A |
| 2 | PF11987.10 | 1.0 | 130 | 317 | same-strand | Translation-initiation factor 2 |
| 3 | PF00009.29 | 1.0 | 130 | 317 | same-strand | Elongation factor Tu GTP binding domain |
| 4 | PF04760.17 | 1.0 | 130 | 317 | same-strand | Translation initiation factor IF-2, N-terminal region |
| 5 | PF01926.25 | 1.0 | 130 | 317.5 | same-strand | 50S ribosome-binding GTPase |
| 6 | PF00071.24 | 0.85 | 110 | 315.5 | same-strand | Ras family |
| 7 | PF00025.23 | 0.87 | 113 | 318.5 | same-strand | ADP-ribosylation factor family |
| 8 | PF02421.20 | 0.78 | 102 | 319.0 | same-strand | Ferrous iron transport protein B |
| 9 | PF01248.28 | 0.97 | 126 | -3 | same-strand | Ribosomal protein L7Ae/L30e/S12e/Gadd45 family |
| 10 | PF08529.13 | 1.0 | 130 | 46 | same-strand | NusA N-terminal domain |
| 11 | PF13184.8 | 0.99 | 129 | 46.0 | same-strand | NusA-like KH domain |
| 12 | PF00575.25 | 0.86 | 112 | 56 | same-strand | S1 RNA binding domain |
| 13 | PF02576.19 | 0.95 | 124 | 1224 | same-strand | RimP N-terminal domain |
| 14 | PF17384.4 | 0.98 | 128 | 1224 | same-strand | RimP C-terminal SH3 domain |
| 15 | PF02811.21 | 0.66 | 86 | 1929 | same-strand | PHP domain |
| 16 | PF00929.26 | 0.66 | 86 | 1929 | same-strand | Exonuclease |
| 17 | PF17657.3 | 0.67 | 87 | 1931.5 | same-strand | Bacterial DNA polymerase III alpha subunit finger domain |
| 18 | PF14579.8 | 0.66 | 86 | 1929 | same-strand | Helix-hairpin-helix motif |
| 19 | PF01509.20 | 0.72 | 93 | 3282.5 | same-strand | TruB family pseudouridylate synthase (N terminal domain) |
| 20 | PF16198.7 | 0.7 | 91 | 3282.5 | same-strand | tRNA pseudouridylate synthase B C-terminal domain |
| 21 | PF04456.14 | 0.6 | 78 | 2492 | same-strand | Protein of unknown function (DUF503) |
| 22 | PF11490.10 | 0.62 | 81 | 1946.5 | same-strand | DNA polymerase III polC-type N-terminus II |
++ More..