Result : EXP01180
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01180 |
| NCBI Accession ID | ABAX03000039.1 |
| Organism | Anaerostipes caccae (strain DSM 14662 / NCIMB 13811 / L1-92) |
| Left | 17997 |
| Right | 18260 |
| Strand | - |
| Nucleotide Sequence | ATGAAAAGTTTTGACGATTTACTAAGCGCGGCAAAAGTATCAGACATTATGCACAAGAAAGACAAAGATGATAATAAAATTGTCTGGGCTCTGGCAATCATCGGTGCAATCGCAGCAGTGGCAGGGATTGCGTATGCAGTCTACAAGTATTTGACTCCAGATTACATGGAAGACTTTGACGATGATTTCGATGACGATTTTGATGATGATTTCTTTGAAGATGAAGATGATATAAAGTTATCTGCAAAAGAGGAAGAAGAATAA |
| Sequence | MKSFDDLLSAAKVSDIMHKKDKDDNKIVWALAIIGAIAAVAGIAYAVYKYLTPDYMEDFDDDFDDDFDDDFFEDEDDIKLSAKEEEE |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 31841667 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1231845 | 1232108 | + | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 2 | 2423432 | 2423695 | - | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP036345.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12698.9 | 1.0 | 2 | 4632.5 | same-strand | ABC-2 family transporter protein |
| 2 | PF09084.13 | 1.0 | 2 | 3539.0 | opposite-strand | NMT1/THI5 like |
| 3 | PF13379.8 | 1.0 | 2 | 3539.0 | opposite-strand | NMT1-like family |
| 4 | PF01371.21 | 1.0 | 2 | 3107.0 | same-strand | Trp repressor protein |
| 5 | PF08876.13 | 1.0 | 2 | 2481.0 | opposite-strand | Domain of unknown function (DUF1836) |
| 6 | PF00580.23 | 1.0 | 2 | 69.0 | same-strand | UvrD/REP helicase N-terminal domain |
| 7 | PF13361.8 | 1.0 | 2 | 69.0 | same-strand | UvrD-like helicase C-terminal domain |
| 8 | PF13245.8 | 1.0 | 2 | 69.0 | same-strand | AAA domain |
| 9 | PF00119.22 | 1.0 | 2 | 2503.0 | same-strand | ATP synthase A chain |
| 10 | PF00137.23 | 1.0 | 2 | 3230.0 | same-strand | ATP synthase subunit C |
++ More..