Result : B2J9K4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Photosystem II reaction center protein T (PSII-T) |
| NCBI Accession ID | CP001037.1 |
| Organism | Nostoc punctiforme (strain ATCC 29133 / PCC 73102) |
| Left | 3086577 |
| Right | 3086684 |
| Strand | - |
| Nucleotide Sequence | ATGGAAAGCGTTGCGTACATCTTGATTTTTACTCTGTGTATAGGTACTATCTTTTTTGCGATCGCATTTCGCGAACCCCCTCGCTTTGAGAAACCAAAAGATAAGTAG |
| Sequence | MESVAYILIFTLCIGTIFFAIAFREPPRFEKPKDK |
| Source of smORF | Swiss-Prot |
| Function | Seems to play a role in the dimerization of PSII. {ECO:0000255|HAMAP-Rule:MF_00808}. |
| Pubmed ID | |
| Domain | CDD:421573 |
| Functional Category | Others |
| Uniprot ID | B2J9K4 |
| ORF Length (Amino Acid) | 35 |
++ More..
| Conservation Analysis |
No. of Species: 26
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3086577 | 3086684 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 2 | 3578851 | 3578958 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 3 | 3113624 | 3113731 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 4 | 5885326 | 5885433 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 5 | 5694044 | 5694148 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 6 | 3137538 | 3137645 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 7 | 2340781 | 2340891 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
| 8 | 4180991 | 4181098 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
| 9 | 1928885 | 1928992 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 10 | 6133473 | 6133571 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 11 | 3073463 | 3073558 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 12 | 3148298 | 3148396 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 13 | 1378745 | 1378840 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 14 | 3886525 | 3886620 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 15 | 4494521 | 4494616 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 16 | 1128623 | 1128718 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 17 | 4046515 | 4046610 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 18 | 1320935 | 1321030 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 19 | 4826844 | 4826939 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 20 | 2280840 | 2280935 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 21 | 2765532 | 2765627 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 22 | 2079314 | 2079409 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 23 | 1603455 | 1603550 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 24 | 619977 | 620075 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 25 | 340260 | 340355 | - | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 26 | 1785377 | 1785481 | + | NZ_CP035504.1 | Kocuria indica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010628.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00702.28 | 0.65 | 17 | 1847 | same-strand | haloacid dehalogenase-like hydrolase |
| 2 | PF00575.25 | 0.88 | 23 | 767 | same-strand | S1 RNA binding domain |
| 3 | PF00421.21 | 0.77 | 20 | 112.5 | same-strand | Photosystem II protein |
++ More..