Result : EXP01178
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01178 |
| NCBI Accession ID | CP036346.1 |
| Organism | Erysipelatoclostridium ramosum DSM 1402 |
| Left | 762146 |
| Right | 762406 |
| Strand | + |
| Nucleotide Sequence | ATGAGAAAAGAGGTGATTACTATCGCAAATACAGGAAAACGTCGCGTGTGTCGTTGTATCAAGACAATGAATATTGTAATTGGTAAAGAACAGCGGGATCTATTTACTAAGGGCCAAGTTTACGATTGTGTGATTCGTGATAGTGGTCAGCTTCAGGTAAATTATAAAATATATGGTAAAGAGTTTGATTTGTCATGTACTAAAGAGGAATTTGAAGAAAACTTTGTTTTAATAAATAAAAAAACGGGGGTTAGAAAATGA |
| Sequence | MRKEVITIANTGKRRVCRCIKTMNIVIGKEQRDLFTKGQVYDCVIRDSGQLQVNYKIYGKEFDLSCTKEEFEENFVLINKKTGVRK |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 31841667 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2041884 | 2042144 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 2 | 543463 | 543714 | + | NZ_AP024085.1 | Faecalibacillus intestinalis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP068170.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00849.24 | 1.0 | 2 | 2302.5 | same-strand | RNA pseudouridylate synthase |
| 2 | PF00122.22 | 1.0 | 2 | 320.0 | same-strand | E1-E2 ATPase |
| 3 | PF00009.29 | 1.0 | 2 | 1526.0 | same-strand | Elongation factor Tu GTP binding domain |
| 4 | PF16658.7 | 1.0 | 2 | 1526.0 | same-strand | Class II release factor RF3, C-terminal domain |
| 5 | PF03144.27 | 1.0 | 2 | 1526.0 | same-strand | Elongation factor Tu domain 2 |
| 6 | PF01926.25 | 1.0 | 2 | 1526.0 | same-strand | 50S ribosome-binding GTPase |
++ More..