Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01176 |
NCBI Accession ID | AE015928.1 |
Organism | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) |
Left | 494471 |
Right | 494728 |
Strand | - |
Nucleotide Sequence | ATGAGTGCGCAAACACCTGCCAAAATTACATTAGAAGAGATCACCCAACGCAAAAAGAAGCTCTTGAATGAAATTCAGGCTCAAAAAAGAGCTATGACGGCCACCACCCGCGAAATATTCTCGCCTCTTGCACCCGCTGCCAACAAAGCGGATTCGCTCATGCGTTCGTTCAATACCGGCATGGCCATCTTTGACGGAGTAGTTTTGGGTATCAAGATCATGAAAAAAATGCGGACGTACTTTAGAAGACTAAGATAG |
Sequence | MSAQTPAKITLEEITQRKKKLLNEIQAQKRAMTATTREIFSPLAPAANKADSLMRSFNTGMAIFDGVVLGIKIMKKMRTYFRRLR |
Source of smORF | Protein-level |
Function | |
Pubmed ID | 31841667 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 85 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4072567 | 4072824 | - | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
2 | 331088 | 331345 | - | NZ_CP012938.1 | Bacteroides ovatus |
3 | 1613883 | 1614143 | - | NZ_CP015401.2 | Bacteroides caecimuris |
4 | 1920883 | 1921146 | - | NZ_LN877293.1 | Bacteroides fragilis |
5 | 509505 | 509732 | - | NZ_CP027234.1 | Bacteroides heparinolyticus |
6 | 233974 | 234201 | - | NZ_CP027231.1 | Bacteroides zoogleoformans |
7 | 3407771 | 3408001 | + | NC_014933.1 | Bacteroides helcogenes P 36-108 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF05036.15 | 1.0 | 7 | 1696 | opposite-strand | SPOR domain |