Result : EXP01175
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01175 |
| NCBI Accession ID | AY171301.1 |
| Organism | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) |
| Left | 25675 |
| Right | 25932 |
| Strand | - |
| Nucleotide Sequence | ATGGCAAAGAAGAACGATTTAAAAAACAGTATGTCGGCCGGGCTGACCGGGGGATTAGACAGCCTGATCCAATCCACGGCCGGGCAAAAAGAGGCTCAAAAGCCGAAGAAAGCGAAAACCGTGCATTGTAATTTTGTCATGGACGAAACCTATCACCAGAACTTAAAGCTGATCGCGATCCGCAAAGGCGATTCGCTAAAATCGGTATTGCAAGAGGCTATATCTGACTACTTGGATAAAAACAGTTCCCTGCTATAA |
| Sequence | MAKKNDLKNSMSAGLTGGLDSLIQSTAGQKEAQKPKKAKTVHCNFVMDETYHQNLKLIAIRKGDSLKSVLQEAISDYLDKNSSLL |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 31841667 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 31027 | 31284 | - | NZ_CP040529.1 | Bacteroides thetaiotaomicron |
| 2 | 2028470 | 2028727 | + | NZ_LT906459.1 | Odoribacter splanchnicus |
| 3 | 172491 | 172748 | + | NZ_AP019736.1 | Alistipes dispar |
| 4 | 3547152 | 3547409 | - | NC_018011.1 | Alistipes finegoldii DSM 17242 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT906459.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12099.10 | 1.0 | 4 | 2272.0 | opposite-strand | Protein of unknown function (DUF3575) |
| 2 | PF17145.6 | 0.75 | 3 | 1354 | opposite-strand | Domain of unknown function (DUF5119) |
| 3 | PF13149.8 | 1.0 | 4 | 189.0 | opposite-strand | Fimbrillin-like |
| 4 | PF00196.21 | 0.75 | 3 | 3790 | same-strand | Bacterial regulatory proteins, luxR family |
++ More..