Result : EXP01173
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01173 |
| NCBI Accession ID | ABFX02000002.1 |
| Organism | Erysipelatoclostridium ramosum DSM 1402 |
| Left | 98557 |
| Right | 98808 |
| Strand | - |
| Nucleotide Sequence | ATGGTTATGGAAATTAAATTTCAACCTCAAGGGGTATGCTCAAAACAAATAGTTATTGACGTTGAGGATGGCATTGTTAATAACGTAAAATTTATTGGTGGATGTTCTGGTAATACACAAGGTGTTGGAGCATTAGCAAAAGGGATGCAAGTAAATGAGGTAATCGAACGATTACAAGGTATTCGTTGTGGGGCAAGACCAACTAGTTGTCCTGATCAATTAGCTAAAGCATTAGTTAAACATGCGATGTAG |
| Sequence | MVMEIKFQPQGVCSKQIVIDVEDGIVNNVKFIGGCSGNTQGVGALAKGMQVNEVIERLQGIRCGARPTSCPDQLAKALVKHAM |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl14834. Profile Description: TSCPD domain. This model describes a family of conserved hypothetical proteins of small size, typically ~85 residues, with four invariant Cys residues. This small protein is distantly homologous to a C-terminal domain found in proteins identified by N-terminal homology as ribonucleotide reductases. The rare and sporadic distribution of this protein family falls mostly within the subset of bacterial genomes containing the uncharacterized radical SAM protein modeled by TIGR03904. [Unknown function, General] |
| Pubmed ID | 31841667 |
| Domain | CDD:417501 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 83 |
++ More..
| Conservation Analysis |
No. of Species: 106
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1739682 | 1739927 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 2 | 1916002 | 1916247 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 3 | 1373016 | 1373261 | + | NZ_LT990039.1 | Massilistercora timonensis |
| 4 | 128292 | 128540 | - | NZ_CP027228.1 | Mogibacterium diversum |
| 5 | 930382 | 930627 | + | NZ_CP069440.1 | Phocaeicola coprophilus |
| 6 | 329613 | 329855 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 7 | 3429005 | 3429211 | + | NZ_CP048436.1 | Flavonifractor plautii |
| 8 | 616268 | 616513 | - | NZ_CP027231.1 | Bacteroides zoogleoformans |
| 9 | 2394225 | 2394473 | - | NZ_LR027382.1 | Alistipes megaguti |
| 10 | 810913 | 811158 | - | NC_015164.1 | Phocaeicola salanitronis DSM 18170 |
| 11 | 2312566 | 2312811 | - | NZ_CP015401.2 | Bacteroides caecimuris |
| 12 | 37351 | 37596 | - | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 13 | 59346 | 59594 | - | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 14 | 61831 | 62079 | - | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 15 | 4353109 | 4353354 | + | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 16 | 3014546 | 3014752 | - | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 17 | 656865 | 657113 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 18 | 2661510 | 2661752 | + | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 19 | 1726017 | 1726271 | - | NZ_CP029462.1 | Megasphaera stantonii |
| 20 | 3541833 | 3542078 | + | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 21 | 1129072 | 1129314 | - | NZ_CP027234.1 | Bacteroides heparinolyticus |
| 22 | 2093680 | 2093955 | + | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 23 | 1303313 | 1303549 | - | NZ_CP012938.1 | Bacteroides ovatus |
| 24 | 1235207 | 1235452 | - | NZ_HF545616.1 | Ruminococcus bicirculans |
| 25 | 4650429 | 4650674 | + | NZ_LR699004.1 | Phocaeicola dorei |
| 26 | 2701603 | 2701854 | - | NZ_CP014223.1 | Anaerotignum propionicum DSM 1682 |
| 27 | 2225797 | 2226039 | + | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 28 | 3106563 | 3106808 | - | NC_014933.1 | Bacteroides helcogenes P 36-108 |
| 29 | 1391296 | 1391550 | + | NZ_CP009687.1 | Clostridium aceticum |
| 30 | 2361232 | 2361474 | - | NC_014393.1 | Clostridium cellulovorans 743B |
| 31 | 1307303 | 1307554 | - | NZ_CP030775.1 | Clostridium butyricum |
| 32 | 4323128 | 4323373 | + | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
| 33 | 2016820 | 2017068 | + | NC_014624.2 | Eubacterium callanderi |
| 34 | 1643935 | 1644189 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 35 | 993032 | 993274 | + | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 36 | 2935144 | 2935389 | - | NZ_LN877293.1 | Bacteroides fragilis |
| 37 | 1972373 | 1972630 | - | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 38 | 2145981 | 2146226 | + | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 39 | 3753082 | 3753330 | + | NZ_CP019962.1 | Eubacterium limosum |
| 40 | 764425 | 764664 | + | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 41 | 417796 | 418041 | - | NZ_CP030280.1 | Blautia argi |
| 42 | 2162150 | 2162401 | - | NZ_CP070062.1 | Coprococcus comes |
| 43 | 1507049 | 1507255 | + | NC_014960.1 | Anaerolinea thermophila UNI-1 |
| 44 | 3143214 | 3143462 | - | NC_018011.1 | Alistipes finegoldii DSM 17242 |
| 45 | 4582778 | 4583026 | - | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 46 | 3146793 | 3147038 | - | NZ_CP023671.1 | Clostridium septicum |
| 47 | 2544614 | 2544859 | - | NZ_CP036259.1 | Sporomusa termitida |
| 48 | 3030946 | 3031152 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 49 | 108533 | 108787 | + | NZ_CP048649.1 | Aminipila butyrica |
| 50 | 703737 | 703994 | + | NZ_LT906459.1 | Odoribacter splanchnicus |
| 51 | 582395 | 582646 | - | NZ_CP039126.1 | Blautia producta |
| 52 | 773129 | 773398 | - | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 53 | 1386181 | 1386432 | - | NZ_LR215980.1 | Paraprevotella xylaniphila YIT 11841 |
| 54 | 1803734 | 1803991 | + | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 55 | 193834 | 194076 | - | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 56 | 340902 | 341156 | - | NZ_CP015402.2 | Muribaculum intestinale |
| 57 | 71622 | 71861 | + | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 58 | 3218150 | 3218398 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 59 | 1084382 | 1084630 | - | NZ_CP053187.1 | Turicibacter sanguinis |
| 60 | 2879702 | 2879953 | - | NZ_AP023049.1 | Alistipes indistinctus |
| 61 | 1668690 | 1668935 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 62 | 1254588 | 1254791 | + | NZ_CP054012.1 | Parabacteroides distasonis |
| 63 | 1099169 | 1099378 | - | NZ_CP034413.2 | Dysosmobacter welbionis |
| 64 | 2496331 | 2496585 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 65 | 3702293 | 3702514 | + | NZ_AP018449.1 | Methylomusa anaerophila |
| 66 | 2626989 | 2627246 | - | NZ_AP019735.1 | Alistipes communis |
| 67 | 2182672 | 2182935 | - | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 68 | 3577534 | 3577782 | + | NZ_CP011663.1 | Clostridium sporogenes |
| 69 | 2221173 | 2221433 | - | NZ_CP011402.1 | Denitrobacterium detoxificans |
| 70 | 1135522 | 1135761 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 71 | 3529705 | 3529959 | + | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 72 | 1074607 | 1074852 | - | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 73 | 843811 | 844059 | - | NZ_CP032416.1 | Clostridium fermenticellae |
| 74 | 3334521 | 3334781 | + | NZ_CP028842.1 | Clostridium botulinum |
| 75 | 519591 | 519839 | - | NZ_CP045696.1 | Sodaliphilus pleomorphus |
| 76 | 940774 | 941031 | - | NC_008593.1 | Clostridium novyi NT |
| 77 | 1797199 | 1797444 | + | NZ_CP014204.2 | Clostridium baratii |
| 78 | 1938668 | 1938910 | + | NZ_LT906477.1 | Clostridium cochlearium |
| 79 | 3023585 | 3023839 | - | NZ_CP069450.1 | Butyricimonas virosa |
| 80 | 2366188 | 2366433 | + | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 81 | 61342 | 61590 | - | NZ_LN879430.1 | Herbinix luporum |
| 82 | 1947119 | 1947376 | - | NZ_CP043998.1 | Clostridium diolis |
| 83 | 1634247 | 1634501 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 84 | 1894454 | 1894696 | - | NC_011979.1 | Geobacter daltonii FRC-32 |
| 85 | 5077670 | 5077921 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 86 | 465814 | 466071 | + | NC_015578.1 | Treponema primitia ZAS-2 |
| 87 | 743354 | 743614 | - | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 88 | 2316335 | 2316574 | - | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 89 | 2710183 | 2710422 | + | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 90 | 781180 | 781431 | - | NZ_CP016786.1 | Clostridium isatidis |
| 91 | 3083671 | 3083895 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 92 | 217044 | 217292 | + | NZ_AP019736.1 | Alistipes dispar |
| 93 | 846691 | 846942 | - | NZ_HG917868.1 | Clostridium bornimense |
| 94 | 1457980 | 1458231 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 95 | 3784960 | 3785211 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 96 | 119012 | 119257 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 97 | 2745894 | 2746154 | + | NZ_LR699011.1 | Roseburia hominis |
| 98 | 2037872 | 2038114 | + | NZ_LR590481.1 | Hathewaya histolytica |
| 99 | 4045684 | 4045926 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 100 | 1771961 | 1772212 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 101 | 1487381 | 1487647 | - | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 102 | 3189108 | 3189374 | + | NZ_CP035807.1 | Thiospirochaeta perfilievii |
| 103 | 3996983 | 3997246 | - | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 104 | 3510854 | 3511102 | + | NC_016633.1 | Sphaerochaeta pleomorpha str. Grapes |
| 105 | 3044127 | 3044369 | + | NZ_CP028105.1 | Fusobacterium ulcerans |
| 106 | 2684298 | 2684540 | - | NZ_CP028103.1 | Fusobacterium varium ATCC 27725 |
| 107 | 3516690 | 3516974 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
++ More..