Result : EXP01172
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01172 |
| NCBI Accession ID | AE015928.1 |
| Organism | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) |
| Left | 1012705 |
| Right | 1012953 |
| Strand | + |
| Nucleotide Sequence | ATGGCACAACATACTTATGATGAAGAATCGGTCCAGGAGCTGTTGGGCTGGGCGAAAAAGATGCTTGAAACAAAGAATTACCCGACAGAAAAGTATCAGGTTAATGCGTGTACTTCAATCATTGATGGTAAACTTTATCTGGAGTCTTTAATTTCGATGATTTCCAAAAACTGGGAAAATCCGACTTTTCATCCTACCATTGAGCAACTGTGGGAATATAGAGAAAAGTGGGAAGGTCAAAAGGAGTAA |
| Sequence | MAQHTYDEESVQELLGWAKKMLETKNYPTEKYQVNACTSIIDGKLYLESLISMISKNWENPTFHPTIEQLWEYREKWEGQKE |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 31841667 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4590800 | 4591048 | + | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 2 | 1012224 | 1012472 | - | NZ_CP012938.1 | Bacteroides ovatus |
| 3 | 2097078 | 2097326 | - | NZ_CP015401.2 | Bacteroides caecimuris |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP040530.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01103.25 | 1.0 | 3 | 2264 | same-strand | Omp85 superfamily domain |
| 2 | PF11810.10 | 1.0 | 3 | 1213 | opposite-strand | Domain of unknown function (DUF3332) |
| 3 | PF07681.14 | 1.0 | 3 | 670 | opposite-strand | DoxX |
| 4 | PF04170.14 | 0.67 | 2 | 1672.5 | opposite-strand | NlpE N-terminal domain |
| 5 | PF07690.18 | 1.0 | 3 | 632 | same-strand | Major Facilitator Superfamily |
| 6 | PF12706.9 | 1.0 | 3 | 2103 | same-strand | Beta-lactamase superfamily domain |
| 7 | PF02614.16 | 1.0 | 3 | 4043 | opposite-strand | Glucuronate isomerase |
| 8 | PF13407.8 | 0.67 | 2 | 5289.5 | same-strand | Periplasmic binding protein domain |
| 9 | PF00356.23 | 0.67 | 2 | 5289.5 | same-strand | Bacterial regulatory proteins, lacI family |
++ More..