Result : EXP01171
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01171 |
| NCBI Accession ID | AE015928.1 |
| Organism | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) |
| Left | 6016568 |
| Right | 6016816 |
| Strand | + |
| Nucleotide Sequence | ATGGATGTAATAACAAATAAAGAGGTAAACGTTTATCTTGATAATGAAAAAGGAACATTGTGCTTAACAGGAATGTTGGTAGGTACAATGGTATTTTTATATGATTCGCAGGGGGAGCTGAAAGAGAAACATAGATTTGCCTTGCCTTCACTCACTTTGGAGATATCCAGAAAAGGTACTTATGTCTTAGTCATGAGCCATCCTAATTGTCAGCCGGAAGTAAGAAGAATTATATATTCAGGAATATAA |
| Sequence | MDVITNKEVNVYLDNEKGTLCLTGMLVGTMVFLYDSQGELKEKHRFALPSLTLEISRKGTYVLVMSHPNCQPEVRRIIYSGI |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 31841667 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3317930 | 3318178 | + | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 2 | 6197976 | 6198224 | + | NZ_CP012938.1 | Bacteroides ovatus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP040530.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02699.17 | 1.0 | 2 | 2443.0 | same-strand | Preprotein translocase subunit |
| 2 | PF07949.14 | 1.0 | 2 | 1408.5 | same-strand | YbbR-like protein |
| 3 | PF01121.22 | 1.0 | 2 | 803.0 | same-strand | Dephospho-CoA kinase |
| 4 | PF18347.3 | 1.0 | 2 | 349.0 | same-strand | Domain of unknown function (DUF5606) |
| 5 | PF07724.16 | 1.0 | 2 | 58.5 | opposite-strand | AAA domain (Cdc48 subfamily) |
| 6 | PF17871.3 | 1.0 | 2 | 58.5 | opposite-strand | AAA lid domain |
| 7 | PF00004.31 | 1.0 | 2 | 58.5 | opposite-strand | ATPase family associated with various cellular activities (AAA) |
| 8 | PF10431.11 | 1.0 | 2 | 58.5 | opposite-strand | C-terminal, D2-small domain, of ClpB protein |
| 9 | PF07728.16 | 1.0 | 2 | 58.5 | opposite-strand | AAA domain (dynein-related subfamily) |
| 10 | PF02861.22 | 1.0 | 2 | 58.5 | opposite-strand | Clp amino terminal domain, pathogenicity island component |
| 11 | PF03466.22 | 1.0 | 2 | 3551.5 | same-strand | LysR substrate binding domain |
| 12 | PF00126.29 | 1.0 | 2 | 3551.5 | same-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
++ More..