Result : EXP01170
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01170 |
| NCBI Accession ID | CP036346.1 |
| Organism | Erysipelatoclostridium ramosum DSM 1402 |
| Left | 1112899 |
| Right | 1113144 |
| Strand | + |
| Nucleotide Sequence | ATGGCAAAATGTAAATTATTAATGCAAACTGCACAAACACAAAAATTAATCGATTTTTTTGATGGATATGAAGATGATAAAGTAAAATGTAAATTCATTAAAAAAACTGGAATCAAGGCTGAAATTGAATGTGAAACAGAACTTACACCAGATGAAGCAGCTGGACATTGTAAGAGTCTTTTTAAAAAGACACCTGATGGAGCAGTTTTATACTTCTCTATTCAACCAGATGGATTCTTCGGATAA |
| Sequence | MAKCKLLMQTAQTQKLIDFFDGYEDDKVKCKFIKKTGIKAEIECETELTPDEAAGHCKSLFKKTPDGAVLYFSIQPDGFFG |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 31841667 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 81 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1654720 | 1654965 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 2 | 603732 | 603977 | + | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 3 | 1044601 | 1044846 | + | NZ_AP019309.1 | Intestinibaculum porci |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP024085.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00488.23 | 1.0 | 3 | 4036 | same-strand | MutS domain V |
| 2 | PF05192.20 | 1.0 | 3 | 4036 | same-strand | MutS domain III |
| 3 | PF01624.22 | 1.0 | 3 | 4036 | same-strand | MutS domain I |
| 4 | PF05190.20 | 1.0 | 3 | 4036 | same-strand | MutS family domain IV |
| 5 | PF05188.19 | 0.67 | 2 | 4078.5 | same-strand | MutS domain II |
| 6 | PF10628.11 | 0.67 | 2 | 3526.5 | same-strand | Outer spore coat protein E (CotE) |
| 7 | PF00478.27 | 1.0 | 3 | 1963 | same-strand | IMP dehydrogenase / GMP reductase domain |
| 8 | PF06133.13 | 1.0 | 3 | 1526 | same-strand | Control of competence regulator ComK, YlbF/YmcA |
| 9 | PF04055.23 | 1.0 | 3 | 85 | same-strand | Radical SAM superfamily |
| 10 | PF00919.22 | 1.0 | 3 | 85 | same-strand | Uncharacterized protein family UPF0004 |
| 11 | PF01938.22 | 1.0 | 3 | 85 | same-strand | TRAM domain |
| 12 | PF04232.14 | 0.67 | 2 | 93.5 | same-strand | Stage V sporulation protein S (SpoVS) |
| 13 | PF13277.8 | 1.0 | 3 | 394 | same-strand | YmdB-like protein |
| 14 | PF12072.10 | 1.0 | 3 | 1234 | same-strand | RNase Y N-terminal region |
| 15 | PF01966.24 | 1.0 | 3 | 1234 | same-strand | HD domain |
| 16 | PF00013.31 | 1.0 | 3 | 1234 | same-strand | KH domain |
| 17 | PF00154.23 | 0.67 | 2 | 4173.5 | same-strand | recA bacterial DNA recombination protein |
| 18 | PF08423.13 | 0.67 | 2 | 4173.5 | same-strand | Rad51 |
| 19 | PF00149.30 | 0.67 | 2 | 242.0 | same-strand | Calcineurin-like phosphoesterase |
++ More..