Result : B2J663
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Gas vesicle structural protein (GVP) |
| NCBI Accession ID | CP001037.1 |
| Organism | Nostoc punctiforme (strain ATCC 29133 / PCC 73102) |
| Left | 2628002 |
| Right | 2628223 |
| Strand | + |
| Nucleotide Sequence | ATGGCTGTTGAAAAAGTTAACTCATCTTCAAGTCTGGCTGAAGTTATTGACCGCATCTTGGACAAAGGAATTGTAATTGATGCTTGGGTACGTGTTTCTTTAGTTGGTATTGAACTGCTATCAATAGAAGCTCGGATTGTTATTGCTTCAGTTGAAACTTACTTAAGATATGCTGAGGCGGTTGGTTTAACATCTCAGGCTGCTGTTCCATCTGCTGCTTAA |
| Sequence | MAVEKVNSSSSLAEVIDRILDKGIVIDAWVRVSLVGIELLSIEARIVIASVETYLRYAEAVGLTSQAAVPSAA |
| Source of smORF | Swiss-Prot |
| Function | Gas vesicles are small, hollow, gas filled protein structures that are found in several microbial planktonic microorganisms. They allow the positioning of the organism at the favorable depth for growth. GvpA type proteins form the essential core of the structure. {ECO:0000255|HAMAP-Rule:MF_00576}. |
| Pubmed ID | |
| Domain | CDD:413533 |
| Functional Category | Others |
| Uniprot ID | B2J663 |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 32
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2628002 | 2628223 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 2 | 194944 | 195162 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 3 | 2078960 | 2079178 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 4 | 3169 | 3384 | + | NZ_CP031945.1 | Nostoc sphaeroides |
| 5 | 2848 | 3063 | + | NZ_CP031945.1 | Nostoc sphaeroides |
| 6 | 1212269 | 1212484 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 7 | 1212581 | 1212796 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 8 | 1212893 | 1213108 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 9 | 1213205 | 1213420 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 10 | 1393693 | 1393908 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 11 | 1394013 | 1394228 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 12 | 3399955 | 3400170 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 13 | 3399385 | 3399600 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 14 | 3400500 | 3400715 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 15 | 1401147 | 1401365 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 16 | 1403406 | 1403624 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 17 | 3023836 | 3024039 | + | NC_020911.1 | Octadecabacter antarcticus 307 |
| 18 | 62410 | 62613 | + | NC_020910.1 | Octadecabacter arcticus 238 |
| 19 | 1478149 | 1478352 | + | NC_020908.1 | Octadecabacter arcticus 238 |
| 20 | 806815 | 807021 | + | NC_007512.1 | Pelodictyon luteolum DSM 273 |
| 21 | 807084 | 807290 | + | NC_007512.1 | Pelodictyon luteolum DSM 273 |
| 22 | 805320 | 805526 | + | NC_007512.1 | Pelodictyon luteolum DSM 273 |
| 23 | 1564127 | 1564345 | + | NC_008709.1 | Psychromonas ingrahamii 37 |
| 24 | 2130458 | 2130676 | + | NC_008709.1 | Psychromonas ingrahamii 37 |
| 25 | 1999048 | 1999266 | - | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 26 | 1999744 | 1999953 | - | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 27 | 1922554 | 1922760 | - | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
| 28 | 1922295 | 1922501 | - | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
| 29 | 1922036 | 1922242 | - | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
| 30 | 1921777 | 1921983 | - | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
| 31 | 3468087 | 3468305 | - | NZ_CP019948.1 | Methylocystis bryophila |
| 32 | 1080126 | 1080344 | - | NC_014962.1 | Isosphaera pallida ATCC 43644 |
| 33 | 3216950 | 3217165 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 34 | 3298254 | 3298472 | - | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 35 | 2076068 | 2076250 | - | NZ_CP051461.1 | Polaromonas vacuolata |
| 36 | 1087269 | 1087496 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 37 | 1079132 | 1079362 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 38 | 1738371 | 1738583 | + | NC_020453.1 | Bradyrhizobium oligotrophicum S58 |
| 39 | 51750 | 51950 | + | NZ_CP048879.1 | Spartinivicinus ruber |
| 40 | 5713203 | 5713421 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 41 | 2386786 | 2387004 | + | NZ_CP048878.1 | Spartinivicinus ruber |
| 42 | 1292160 | 1292372 | + | NZ_CP009556.1 | Burkholderia oklahomensis C6786 |
| 43 | 53028 | 53255 | - | NC_008553.1 | Methanothrix thermoacetophila PT |
| 44 | 961949 | 962167 | - | NC_008212.1 | Haloquadratum walsbyi DSM 16790 |
| 45 | 2335613 | 2335834 | - | NZ_CP071463.1 | Haloterrigena longa |
| 46 | 2254644 | 2254880 | - | NZ_CP039139.1 | Haloferax mediterranei ATCC 33500 |
| 47 | 729844 | 730050 | - | NC_020388.1 | Natronomonas moolapensis 8.8.11 |
| 48 | 32495 | 32710 | + | NZ_CP038632.1 | Halobacterium salinarum |
| 49 | 331020 | 331208 | + | NC_014735.1 | Halogeometricum borinquense DSM 11551 |
| 50 | 1718333 | 1718515 | - | NC_018719.1 | Candidatus Nitrososphaera gargensis Ga9.2 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010628.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07728.16 | 0.91 | 29 | 1412.0 | same-strand | AAA domain (dynein-related subfamily) |
++ More..