Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01168 |
NCBI Accession ID | CP036346.1 |
Organism | Erysipelatoclostridium ramosum DSM 1402 |
Left | 2687798 |
Right | 2688040 |
Strand | - |
Nucleotide Sequence | ATGGAAGGAATTACAGAAATTAATAAGGATGATTACATTGATAATTGTTTAAAAATTGTCAAAGAGATGATTACTGAAGAAGATTTTAGTGATGAAATCTGGCTTGCTTTAACTGGTGAAATTATGGATACATGTTTATTTATTGGTGGTGATTTTGAAGAAGCAAATATTCGTAATATTACAAACCAATACATTAATAATGGTGGAATTAAACGCTTTAAAAAAGCGCACGAGGTGTTGTAA |
Sequence | MEGITEINKDDYIDNCLKIVKEMITEEDFSDEIWLALTGEIMDTCLFIGGDFEEANIRNITNQYINNGGIKRFKKAHEVL |
Source of smORF | Protein-level |
Function | |
Pubmed ID | 31841667 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 80 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3403829 | 3404071 | + | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
2 | 2479995 | 2480234 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF14821.8 | 1.0 | 2 | 1817.0 | same-strand | Threonine synthase N terminus |
2 | PF00291.27 | 1.0 | 2 | 1817.0 | same-strand | Pyridoxal-phosphate dependent enzyme |
3 | PF00288.28 | 1.0 | 2 | 917.0 | same-strand | GHMP kinases N terminal domain |
4 | PF01381.24 | 1.0 | 2 | 824 | opposite-strand | Helix-turn-helix |
5 | PF12844.9 | 1.0 | 2 | 824 | opposite-strand | Helix-turn-helix domain |