Result : EXP01168
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01168 |
| NCBI Accession ID | CP036346.1 |
| Organism | Erysipelatoclostridium ramosum DSM 1402 |
| Left | 2687798 |
| Right | 2688040 |
| Strand | - |
| Nucleotide Sequence | ATGGAAGGAATTACAGAAATTAATAAGGATGATTACATTGATAATTGTTTAAAAATTGTCAAAGAGATGATTACTGAAGAAGATTTTAGTGATGAAATCTGGCTTGCTTTAACTGGTGAAATTATGGATACATGTTTATTTATTGGTGGTGATTTTGAAGAAGCAAATATTCGTAATATTACAAACCAATACATTAATAATGGTGGAATTAAACGCTTTAAAAAAGCGCACGAGGTGTTGTAA |
| Sequence | MEGITEINKDDYIDNCLKIVKEMITEEDFSDEIWLALTGEIMDTCLFIGGDFEEANIRNITNQYINNGGIKRFKKAHEVL |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 31841667 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3403829 | 3404071 | + | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 2 | 2479995 | 2480234 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP068170.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF14821.8 | 1.0 | 2 | 1817.0 | same-strand | Threonine synthase N terminus |
| 2 | PF00291.27 | 1.0 | 2 | 1817.0 | same-strand | Pyridoxal-phosphate dependent enzyme |
| 3 | PF00288.28 | 1.0 | 2 | 917.0 | same-strand | GHMP kinases N terminal domain |
| 4 | PF01381.24 | 1.0 | 2 | 824 | opposite-strand | Helix-turn-helix |
| 5 | PF12844.9 | 1.0 | 2 | 824 | opposite-strand | Helix-turn-helix domain |
++ More..