Result : EXP01167
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01167 |
| NCBI Accession ID | CP015405.2 |
| Organism | Blautia sp. YL58 |
| Left | 4918157 |
| Right | 4918399 |
| Strand | + |
| Nucleotide Sequence | ATGGGACAGATGGTGGATTTCACCATGGAGCGCGAGGGTCTGGTAAAACCCGGCGACCGCGTAGATCTGAAGGAGGACAGGGCCAGCACCATGTCAGGTATGATGTATTATTATACCATCAAGGATGCCATCGCCATGTCCAGCAATCTGAAACGGCCGCTCACAAAGCTTGCAGGCACTGTGCGCAGGGTCGAACAGCAGGTATCCATTTACATGGTGACTGTGGAGATCGACGAAGAATAA |
| Sequence | MGQMVDFTMEREGLVKPGDRVDLKEDRASTMSGMMYYYTIKDAIAMSSNLKRPLTKLAGTVRRVEQQVSIYMVTVEIDEE |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 31841667 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 853434 | 853676 | + | NZ_CP039126.1 | Blautia producta |
| 2 | 2677519 | 2677761 | - | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 3 | 744146 | 744391 | + | NZ_CP030280.1 | Blautia argi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP030280.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07517.16 | 1.0 | 3 | 103 | same-strand | SecA DEAD-like domain |
| 2 | PF07516.15 | 1.0 | 3 | 103 | same-strand | SecA Wing and Scaffold domain |
| 3 | PF01043.22 | 1.0 | 3 | 103 | same-strand | SecA preprotein cross-linking domain |
| 4 | PF02810.17 | 1.0 | 3 | 103 | same-strand | SEC-C motif |
| 5 | PF03462.20 | 1.0 | 3 | 16 | same-strand | PCRF domain |
| 6 | PF00472.22 | 1.0 | 3 | 16 | same-strand | RF-1 domain |
| 7 | PF13291.8 | 1.0 | 3 | 1212 | same-strand | ACT domain |
| 8 | PF00742.21 | 0.67 | 2 | 1678.0 | same-strand | Homoserine dehydrogenase |
| 9 | PF03447.18 | 0.67 | 2 | 1678.0 | same-strand | Homoserine dehydrogenase, NAD binding domain |
| 10 | PF10143.11 | 1.0 | 3 | 2903 | same-strand | 2,3-bisphosphoglycerate-independent phosphoglycerate mutase |
| 11 | PF01676.20 | 1.0 | 3 | 2903 | same-strand | Metalloenzyme superfamily |
| 12 | PF06161.13 | 0.67 | 2 | 3555.5 | opposite-strand | Protein of unknown function (DUF975) |
| 13 | PF16321.7 | 0.67 | 2 | 5887.0 | same-strand | Sigma 54 modulation/S30EA ribosomal protein C terminus |
| 14 | PF02482.21 | 0.67 | 2 | 5887.0 | same-strand | Sigma 54 modulation protein / S30EA ribosomal protein |
| 15 | PF05173.16 | 0.67 | 2 | 7095.0 | same-strand | Dihydrodipicolinate reductase, C-terminus |
| 16 | PF01113.22 | 0.67 | 2 | 7095.0 | same-strand | Dihydrodipicolinate reductase, N-terminus |
++ More..