Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01166 |
NCBI Accession ID | AE015928.1 |
Organism | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) |
Left | 2976349 |
Right | 2976588 |
Strand | + |
Nucleotide Sequence | ATGGAGAAATATTTAATACACAGCAACGAACTGCATCTGATAGACGCAGGGAAAATCCACCAGGCAGTAGAGAAAATGGTGGAGTCACTCGATCTTGCCGCAGGATCAACCAGTAATTTTGATCTCTATCAGGTAGTAGAAAGCTACTTTAAGGACCTTGAAAAAAGAAGGAAAATCAACCATGTACTGGGGATCAAAGAAGACCGATATGAGTTTGCAGAAGACTTCGGCATCAAATAA |
Sequence | MEKYLIHSNELHLIDAGKIHQAVEKMVESLDLAAGSTSNFDLYQVVESYFKDLEKRRKINHVLGIKEDRYEFAEDFGIK |
Source of smORF | Protein-level |
Function | |
Pubmed ID | 31841667 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 79 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 279094 | 279333 | + | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
2 | 2898242 | 2898481 | + | NZ_CP012938.1 | Bacteroides ovatus |
3 | 720754 | 720993 | - | NZ_LN877293.1 | Bacteroides fragilis |
4 | 1194849 | 1195088 | - | NZ_LR699004.1 | Phocaeicola dorei |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00593.26 | 0.75 | 3 | 2434.0 | same-strand | TonB dependent receptor |
2 | PF07715.17 | 1.0 | 4 | 3444.0 | same-strand | TonB-dependent Receptor Plug Domain |
3 | PF13715.8 | 0.75 | 3 | 3584.0 | same-strand | CarboxypepD reg-like domain |