| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01166 |
| NCBI Accession ID | AE015928.1 |
| Organism | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) |
| Left | 2976349 |
| Right | 2976588 |
| Strand | + |
| Nucleotide Sequence | ATGGAGAAATATTTAATACACAGCAACGAACTGCATCTGATAGACGCAGGGAAAATCCACCAGGCAGTAGAGAAAATGGTGGAGTCACTCGATCTTGCCGCAGGATCAACCAGTAATTTTGATCTCTATCAGGTAGTAGAAAGCTACTTTAAGGACCTTGAAAAAAGAAGGAAAATCAACCATGTACTGGGGATCAAAGAAGACCGATATGAGTTTGCAGAAGACTTCGGCATCAAATAA |
| Sequence | MEKYLIHSNELHLIDAGKIHQAVEKMVESLDLAAGSTSNFDLYQVVESYFKDLEKRRKINHVLGIKEDRYEFAEDFGIK |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 31841667 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 79 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 279094 | 279333 | + | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 2 | 2898242 | 2898481 | + | NZ_CP012938.1 | Bacteroides ovatus |
| 3 | 720754 | 720993 | - | NZ_LN877293.1 | Bacteroides fragilis |
| 4 | 1194849 | 1195088 | - | NZ_LR699004.1 | Phocaeicola dorei |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00593.26 | 0.75 | 3 | 2434.0 | same-strand | TonB dependent receptor |
| 2 | PF07715.17 | 1.0 | 4 | 3444.0 | same-strand | TonB-dependent Receptor Plug Domain |
| 3 | PF13715.8 | 0.75 | 3 | 3584.0 | same-strand | CarboxypepD reg-like domain |