Result : EXP01164
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01164 |
| NCBI Accession ID | AY171301.1 |
| Organism | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) |
| Left | 20285 |
| Right | 20521 |
| Strand | - |
| Nucleotide Sequence | ATGGATAAGCACATCATCGGAGAGAACGCAGGGAAACTCTGGCGCTTATTAAGCACAGACGTACACCGAAAATGGACTTTACAAGAAGTCAAGGATGCAACAGGGTTCAATGACCTGGAAGCTGCCAGCGCAATAGGTTGGCTCGCACGTGAGGACAAAATCCAATTCGAACTTGAACACCACAGCACTAAGGATAAGAACGTCTTTTTATACCTTATGCTGAACGTGTATTTTTAA |
| Sequence | MDKHIIGENAGKLWRLLSTDVHRKWTLQEVKDATGFNDLEAASAIGWLAREDKIQFELEHHSTKDKNVFLYLMLNVYF |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of pfam10771. Profile Description: Winged helix-turn-helix domain (DUF2582). This family is conserved in bacteria and archaea. The function is not known. The structure of two proteins in this family were solved using NMR and shown to adopt a winged helix-turn-helix fold. Structural analysis shows that these proteins form an unusual dimeric conformation. This dimer was shown to be similar to that found in the FadR and TubR wHTH domains. It was suggested that these proteins are not very likely to bind to DNA. |
| Pubmed ID | 31841667 |
| Domain | CDD:402413 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 25639 | 25875 | - | NZ_CP040529.1 | Bacteroides thetaiotaomicron |
| 2 | 3364271 | 3364507 | + | NZ_LR699004.1 | Phocaeicola dorei |
| 3 | 452326 | 452562 | + | NZ_LR215980.1 | Paraprevotella xylaniphila YIT 11841 |
| 4 | 1717911 | 1718138 | + | NC_015164.1 | Phocaeicola salanitronis DSM 18170 |
| 5 | 3236933 | 3237160 | + | NZ_CP069440.1 | Phocaeicola coprophilus |
++ More..