Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01161 |
NCBI Accession ID | AE015928.1 |
Organism | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) |
Left | 2803542 |
Right | 2803775 |
Strand | - |
Nucleotide Sequence | ATGAGAAAAAGGAGCAAAAAGTGCCTGAAAATGCACGCTGAGTATACCAAACGGGAACGGCGGATGAGCATTTTGTTGAGCGAAGACGAGCAGTTGATTGTCGATCGTTATCTGGAAAAATACAAGATAACGAATAAGTCACGCTGGCTTCGCGAAACCATTCTCATGTTTATCCATAAAAATATGGAAGAAGATTATCCTACCCTCTTCGGAGAACATGACATGAGACGCTGA |
Sequence | MRKRSKKCLKMHAEYTKRERRMSILLSEDEQLIVDRYLEKYKITNKSRWLRETILMFIHKNMEEDYPTLFGEHDMRR |
Source of smORF | Protein-level |
Function | |
Pubmed ID | 31841667 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 77 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 106286 | 106519 | - | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
2 | 3317510 | 3317743 | - | NZ_CP015401.2 | Bacteroides caecimuris |
3 | 2806574 | 2806807 | - | NZ_CP012938.1 | Bacteroides ovatus |
4 | 788261 | 788494 | + | NZ_LN877293.1 | Bacteroides fragilis |
5 | 2422703 | 2422936 | + | NZ_CP027231.1 | Bacteroides zoogleoformans |
6 | 1725962 | 1726195 | - | NZ_CP027234.1 | Bacteroides heparinolyticus |
7 | 1545053 | 1545286 | + | NC_014933.1 | Bacteroides helcogenes P 36-108 |
8 | 2454499 | 2454732 | + | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
9 | 2576467 | 2576700 | + | NZ_LR699004.1 | Phocaeicola dorei |
10 | 1415861 | 1416094 | - | NC_015164.1 | Phocaeicola salanitronis DSM 18170 |
11 | 4058812 | 4059048 | + | NZ_CP069440.1 | Phocaeicola coprophilus |
12 | 858538 | 858762 | - | NZ_LT605205.1 | Proteiniphilum saccharofermentans |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF07733.14 | 0.67 | 8 | 2414.0 | same-strand | Bacterial DNA polymerase III alpha NTPase domain |
2 | PF17657.3 | 0.67 | 8 | 2414.0 | same-strand | Bacterial DNA polymerase III alpha subunit finger domain |
3 | PF02811.21 | 0.67 | 8 | 2414.0 | same-strand | PHP domain |
4 | PF14579.8 | 0.67 | 8 | 2414.0 | same-strand | Helix-hairpin-helix motif |
5 | PF02666.17 | 0.67 | 8 | 1566.0 | opposite-strand | Phosphatidylserine decarboxylase |
6 | PF01066.23 | 0.67 | 8 | 848.0 | opposite-strand | CDP-alcohol phosphatidyltransferase |
7 | PF16118.7 | 0.67 | 8 | 490.0 | opposite-strand | Domain of unknown function (DUF4834) |
8 | PF14437.8 | 0.67 | 8 | 9.0 | same-strand | MafB19-like deaminase |
9 | PF00383.25 | 1.0 | 12 | 9.0 | same-strand | Cytidine and deoxycytidylate deaminase zinc-binding region |
10 | PF02021.19 | 1.0 | 12 | 106.5 | opposite-strand | Uncharacterised protein family UPF0102 |
11 | PF04237.15 | 0.83 | 10 | 548.0 | opposite-strand | YjbR |
12 | PF03099.21 | 1.0 | 12 | 869.0 | opposite-strand | Biotin/lipoate A/B protein ligase family |