Result : EXP01160
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01160 |
| NCBI Accession ID | AE015928.1 |
| Organism | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) |
| Left | 2147665 |
| Right | 2147895 |
| Strand | - |
| Nucleotide Sequence | ATGAAGAAAATAAAAAAATCGACAGGAGTTGCTATCGCATTCCTTATTTATGTATCAGTAACGGCAGCCTATTTGTTACCTCGCAACACGGAAGTCGGCCAGACGGAGAAGATTCTTACGGTGGTAGGTTCTTACGTCATCGTACTCTTGCTTTGGCTCGTGCTCCGGAAGAAGGAACAAATGCGTGAACGCCGTAAAAAAGACGAACAATCTATTCACTTAAAAAAGTAA |
| Sequence | MKKIKKSTGVAIAFLIYVSVTAAYLLPRNTEVGQTEKILTVVGSYVIVLLLWLVLRKKEQMRERRKKDEQSIHLKK |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 31841667 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5725794 | 5726024 | - | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 2 | 2942229 | 2942459 | - | NZ_CP015401.2 | Bacteroides caecimuris |
| 3 | 2181942 | 2182172 | - | NZ_CP012938.1 | Bacteroides ovatus |
| 4 | 3690555 | 3690776 | - | NC_014933.1 | Bacteroides helcogenes P 36-108 |
| 5 | 3625902 | 3626132 | - | NZ_LN877293.1 | Bacteroides fragilis |
| 6 | 3137809 | 3138027 | - | NZ_CP027234.1 | Bacteroides heparinolyticus |
| 7 | 125666 | 125887 | - | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
| 8 | 141911 | 142132 | - | NZ_LR699004.1 | Phocaeicola dorei |
| 9 | 1182313 | 1182528 | - | NZ_CP027231.1 | Bacteroides zoogleoformans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP040530.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02638.17 | 1.0 | 9 | 3368 | opposite-strand | Glycosyl hydrolase-like 10 |
| 2 | PF17760.3 | 1.0 | 9 | 659 | opposite-strand | UvrA interaction domain |
| 3 | PF13505.8 | 0.78 | 7 | 5 | same-strand | Outer membrane protein beta-barrel domain |
| 4 | PF13722.8 | 1.0 | 9 | 0 | same-strand | 5TM C-terminal transporter carbon starvation CstA |
| 5 | PF01566.20 | 0.67 | 6 | 0.0 | same-strand | Natural resistance-associated macrophage protein |
| 6 | PF14871.8 | 1.0 | 9 | 1537 | opposite-strand | Hypothetical glycosyl hydrolase 6 |
++ More..