Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01160 |
NCBI Accession ID | AE015928.1 |
Organism | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) |
Left | 2147665 |
Right | 2147895 |
Strand | - |
Nucleotide Sequence | ATGAAGAAAATAAAAAAATCGACAGGAGTTGCTATCGCATTCCTTATTTATGTATCAGTAACGGCAGCCTATTTGTTACCTCGCAACACGGAAGTCGGCCAGACGGAGAAGATTCTTACGGTGGTAGGTTCTTACGTCATCGTACTCTTGCTTTGGCTCGTGCTCCGGAAGAAGGAACAAATGCGTGAACGCCGTAAAAAAGACGAACAATCTATTCACTTAAAAAAGTAA |
Sequence | MKKIKKSTGVAIAFLIYVSVTAAYLLPRNTEVGQTEKILTVVGSYVIVLLLWLVLRKKEQMRERRKKDEQSIHLKK |
Source of smORF | Protein-level |
Function | |
Pubmed ID | 31841667 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 76 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 5725794 | 5726024 | - | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
2 | 2942229 | 2942459 | - | NZ_CP015401.2 | Bacteroides caecimuris |
3 | 2181942 | 2182172 | - | NZ_CP012938.1 | Bacteroides ovatus |
4 | 3690555 | 3690776 | - | NC_014933.1 | Bacteroides helcogenes P 36-108 |
5 | 3625902 | 3626132 | - | NZ_LN877293.1 | Bacteroides fragilis |
6 | 3137809 | 3138027 | - | NZ_CP027234.1 | Bacteroides heparinolyticus |
7 | 125666 | 125887 | - | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
8 | 141911 | 142132 | - | NZ_LR699004.1 | Phocaeicola dorei |
9 | 1182313 | 1182528 | - | NZ_CP027231.1 | Bacteroides zoogleoformans |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02638.17 | 1.0 | 9 | 3368 | opposite-strand | Glycosyl hydrolase-like 10 |
2 | PF17760.3 | 1.0 | 9 | 659 | opposite-strand | UvrA interaction domain |
3 | PF13505.8 | 0.78 | 7 | 5 | same-strand | Outer membrane protein beta-barrel domain |
4 | PF13722.8 | 1.0 | 9 | 0 | same-strand | 5TM C-terminal transporter carbon starvation CstA |
5 | PF01566.20 | 0.67 | 6 | 0.0 | same-strand | Natural resistance-associated macrophage protein |
6 | PF14871.8 | 1.0 | 9 | 1537 | opposite-strand | Hypothetical glycosyl hydrolase 6 |