Result : EXP01159
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01159 |
| NCBI Accession ID | CP036346.1 |
| Organism | Erysipelatoclostridium ramosum DSM 1402 |
| Left | 1211810 |
| Right | 1212037 |
| Strand | + |
| Nucleotide Sequence | ATGAAAGATTTATTAAAAAACAAAACTGTATTATCCTTTGTAGGAGGAATTGCAGCAACGATTGCTGGTGCAAAGTTTTTAAAAAGCGATAAAGCTAGAACAATGGCGGTTAATTCTTTAGCTTCGGGAATGAAGCTAAAAGACGATGCGATGGCTACTTATGAAACGATCAAGGAAGATGCAAAAGATATTTGTTACGAAGCAAAAGCTAAAAATGAGGGAGAATAG |
| Sequence | MKDLLKNKTVLSFVGGIAATIAGAKFLKSDKARTMAVNSLASGMKLKDDAMATYETIKEDAKDICYEAKAKNEGE |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 31841667 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 75 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1507885 | 1508112 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 2 | 2560743 | 2560985 | + | NC_014624.2 | Eubacterium callanderi |
| 3 | 1231090 | 1231332 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 4 | 4317189 | 4317431 | + | NZ_CP019962.1 | Eubacterium limosum |
| 5 | 453797 | 453991 | + | NZ_CP048436.1 | Flavonifractor plautii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014624.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 0.8 | 4 | 3690 | same-strand | ABC transporter |
| 2 | PF00664.25 | 0.8 | 4 | 3092.5 | same-strand | ABC transporter transmembrane region |
| 3 | PF02463.21 | 0.8 | 4 | 3960.0 | same-strand | RecF/RecN/SMC N terminal domain |
| 4 | PF00702.28 | 1.0 | 5 | 15.0 | same-strand | haloacid dehalogenase-like hydrolase |
| 5 | PF00122.22 | 1.0 | 5 | 15 | same-strand | E1-E2 ATPase |
| 6 | PF14196.8 | 0.6 | 3 | 1908 | opposite-strand | L-2-amino-thiazoline-4-carboxylic acid hydrolase |
| 7 | PF00258.27 | 0.6 | 3 | 1422 | opposite-strand | Flavodoxin |
| 8 | PF12672.9 | 0.6 | 3 | 834 | opposite-strand | Protein of unknown function (DUF3793) |
| 9 | PF04023.16 | 0.8 | 4 | 323.0 | same-strand | FeoA domain |
| 10 | PF04304.15 | 0.6 | 3 | 2128 | same-strand | Protein of unknown function (DUF454) |
| 11 | PF11756.10 | 0.6 | 3 | 5882 | same-strand | Nitrous oxide-stimulated promoter |
++ More..