Result : B2J4U7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Photosystem II reaction center protein Z (PSII-Z) |
| NCBI Accession ID | CP001037.1 |
| Organism | Nostoc punctiforme (strain ATCC 29133 / PCC 73102) |
| Left | 354738 |
| Right | 354926 |
| Strand | - |
| Nucleotide Sequence | ATGACCATAATATTCCAATTTGCCTTGATCGGTCTAGTCCTATTGTCCTTTGTCTTGGTTGTAGGCGTTCCGGTTGCTTACGCTACTCCCCAAAATTGGGTTGAATCTAAAAAACTGCTCTGGGTTGGTTCTGCCGTCTGGATTGCTTTGGTATTTTTAGTTGGTTTGTTAAACTTTTTTGTCGTGTAG |
| Sequence | MTIIFQFALIGLVLLSFVLVVGVPVAYATPQNWVESKKLLWVGSAVWIALVFLVGLLNFFVV |
| Source of smORF | Swiss-Prot |
| Function | Controls the interaction of photosystem II (PSII) cores with the light-harvesting antenna. {ECO:0000255|HAMAP-Rule:MF_00644}. |
| Pubmed ID | |
| Domain | CDD:421516 |
| Functional Category | Others |
| Uniprot ID | B2J4U7 |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 25
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 354738 | 354926 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 2 | 4368984 | 4369172 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
| 3 | 5415867 | 5416055 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 4 | 3301815 | 3302003 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 5 | 184059 | 184247 | - | NZ_CP031941.1 | Nostoc sphaeroides |
| 6 | 6497944 | 6498132 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 7 | 2094252 | 2094440 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 8 | 7207138 | 7207326 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 9 | 1925492 | 1925680 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 10 | 2048966 | 2049154 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 11 | 4671768 | 4671938 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 12 | 1604853 | 1605041 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 13 | 542287 | 542475 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 14 | 3418722 | 3418910 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 15 | 565082 | 565270 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 16 | 2266459 | 2266647 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 17 | 2939931 | 2940119 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 18 | 3522890 | 3523078 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 19 | 5975845 | 5976045 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 20 | 3655626 | 3655814 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 21 | 934939 | 935127 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 22 | 1836405 | 1836593 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 23 | 1334928 | 1335116 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 24 | 3840283 | 3840471 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 25 | 5470301 | 5470489 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010628.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00885.21 | 0.84 | 21 | 164 | same-strand | 6,7-dimethyl-8-ribityllumazine synthase |
| 2 | PF01743.22 | 0.64 | 16 | 208.0 | opposite-strand | Poly A polymerase head domain |
| 3 | PF00571.30 | 0.64 | 16 | 208.0 | opposite-strand | CBS domain |
++ More..