Result : EXP01156
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01156 |
| NCBI Accession ID | AE015928.1 |
| Organism | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) |
| Left | 1843686 |
| Right | 1843910 |
| Strand | + |
| Nucleotide Sequence | ATGGGAAAAAAAGTTGAATATACCAATGGCGAACTAACCATTGCATGGCAGCCGGAAATGTGCCAGCATGCAGGAATCTGCGTAAAAATGTTACCCAATGTTTACCACCCGAAAGAGAGGCCGTGGGTACAAATCGAGAATGCTACAACGGAAGAGCTAATTGCACAAATCAGTAAATGTCCGTCGGGAGCATTAAGTTACAGACTGAACAAGAAAGATAAGTAA |
| Sequence | MGKKVEYTNGELTIAWQPEMCQHAGICVKMLPNVYHPKERPWVQIENATTEELIAQISKCPSGALSYRLNKKDK |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl19102. Profile Description: 4Fe-4S dicluster domain. Domain II of the enzyme dihydroprymidine dehydrogenase binds FAD. Dihydroprymidine dehydrogenase catalyzes the first and rate-limiting step of pyrimidine degradation by converting pyrimidines to the corresponding 5,6- dihydro compounds. This domain carries two Fe4-S4 clusters. |
| Pubmed ID | 31841667 |
| Domain | CDD:418523 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 74 |
++ More..
| Conservation Analysis |
No. of Species: 50
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5421815 | 5422039 | + | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 2 | 1897620 | 1897844 | + | NZ_CP012938.1 | Bacteroides ovatus |
| 3 | 1814991 | 1815206 | - | NZ_LN877293.1 | Bacteroides fragilis |
| 4 | 4120997 | 4121221 | - | NZ_CP054012.1 | Parabacteroides distasonis |
| 5 | 1877403 | 1877618 | - | NZ_CP069450.1 | Butyricimonas virosa |
| 6 | 2140074 | 2140292 | - | NZ_AP023049.1 | Alistipes indistinctus |
| 7 | 3369697 | 3369918 | + | NC_018011.1 | Alistipes finegoldii DSM 17242 |
| 8 | 3262826 | 3263056 | + | NZ_CP023777.1 | Chitinophaga caeni |
| 9 | 1629557 | 1629760 | - | NZ_CP013210.1 | Empedobacter brevis |
| 10 | 2594851 | 2595057 | + | NZ_CP040908.1 | Empedobacter falsenii |
| 11 | 1581167 | 1581370 | + | NZ_CP053698.1 | Empedobacter stercoris |
| 12 | 1500048 | 1500257 | - | NZ_CP012040.1 | Cyclobacterium amurskyense |
| 13 | 2660933 | 2661166 | - | NZ_CP031124.1 | Ephemeroptericola cinctiostellae |
| 14 | 3490061 | 3490267 | - | NC_015945.1 | Muricauda ruestringensis DSM 13258 |
| 15 | 144906 | 145112 | + | NZ_CP030104.1 | Flagellimonas maritima |
| 16 | 2212315 | 2212533 | - | NZ_CP033932.1 | Chryseobacterium bernardetii |
| 17 | 4006302 | 4006529 | - | NZ_CP030848.1 | Sphingobacterium hotanense |
| 18 | 202919 | 203134 | + | NZ_CP033920.1 | Chryseobacterium carnipullorum |
| 19 | 4221159 | 4221377 | - | NZ_CP033926.1 | Chryseobacterium joostei |
| 20 | 4612658 | 4612876 | - | NZ_LR134289.1 | Chryseobacterium gleum |
| 21 | 3367143 | 3367352 | - | NC_016599.1 | Owenweeksia hongkongensis DSM 17368 |
| 22 | 2593145 | 2593363 | - | NZ_CP033924.1 | Chryseobacterium lactis |
| 23 | 1117113 | 1117331 | - | NZ_CP033914.1 | Chryseobacterium shandongense |
| 24 | 1236913 | 1237131 | - | NZ_LR134386.1 | Chryseobacterium nakagawai |
| 25 | 83421 | 83627 | + | NZ_CP029463.1 | Flavobacterium sediminis |
| 26 | 2259428 | 2259610 | + | NZ_CP023049.2 | Chryseobacterium piperi |
| 27 | 328169 | 328363 | + | NZ_CP007035.1 | Niabella soli DSM 19437 |
| 28 | 2262957 | 2263175 | + | NZ_CP050995.1 | Chryseobacterium gallinarum |
| 29 | 1618947 | 1619177 | - | NZ_CP017479.1 | Flavobacterium gilvum |
| 30 | 923471 | 923689 | + | NZ_CP015199.1 | Chryseobacterium glaciei |
| 31 | 2877016 | 2877225 | + | NZ_CP029480.1 | Arcticibacterium luteifluviistationis |
| 32 | 461467 | 461649 | + | NZ_CP049246.1 | Sphingobacterium lactis |
| 33 | 378169 | 378396 | + | NZ_LR590470.1 | Sphingobacterium daejeonense |
| 34 | 1353755 | 1353988 | + | NZ_CP029187.1 | Flavobacterium pallidum |
| 35 | 2249981 | 2250202 | + | NZ_CP038029.1 | Sphingobacterium psychroaquaticum |
| 36 | 1663208 | 1663396 | + | NZ_CP032382.1 | Chryseolinea soli |
| 37 | 1998224 | 1998439 | + | NZ_CP014337.1 | Elizabethkingia bruuniana |
| 38 | 1016677 | 1016904 | + | NZ_CP016907.1 | Flavobacterium anhuiense |
| 39 | 78772 | 78972 | - | NC_016609.1 | Niastella koreensis GR20-10 |
| 40 | 1531420 | 1531623 | + | NC_015844.1 | Zobellia galactanivorans |
| 41 | 294384 | 294569 | + | NZ_CP038810.1 | Flavobacterium sangjuense |
| 42 | 653335 | 653547 | - | NZ_CP015067.2 | Elizabethkingia anophelis |
| 43 | 2007409 | 2007639 | - | NC_009441.1 | Flavobacterium johnsoniae UW101 |
| 44 | 840985 | 841215 | + | NZ_CP043612.1 | Flavobacterium nitrogenifigens |
| 45 | 2544790 | 2545017 | + | NC_017025.1 | Flavobacterium indicum GPTSA100-9 = DSM 17447 |
| 46 | 1258414 | 1258617 | + | NZ_CP028811.1 | Flavobacterium magnum |
| 47 | 2209559 | 2209786 | - | NZ_CP017774.1 | Flavobacterium commune |
| 48 | 3970400 | 3970615 | - | NZ_CP042436.1 | Mucilaginibacter ginsenosidivorans |
| 49 | 1266054 | 1266269 | - | NC_014655.1 | Leadbetterella byssophila DSM 17132 |
| 50 | 2637103 | 2637315 | + | NZ_CP042831.1 | Flavobacterium alkalisoli |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP040530.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF14542.8 | 0.62 | 31 | 399.0 | same-strand | GCN5-related N-acetyl-transferase |
++ More..