Result : EXP01155
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01155 |
| NCBI Accession ID | CP015405.2 |
| Organism | Blautia sp. YL58 |
| Left | 4702494 |
| Right | 4702715 |
| Strand | - |
| Nucleotide Sequence | ATGTCAGAAAAATACTATGAAACATATGCATTTGAACCCGGCAGCCTTGTCTGCGACAAATGCGGCACAGCGCTTGAAGCGGGTGAGGTGGTGCTGCATTATATGGGAAACGATTTCCCTATTGAAATGCCGAAATGTCCTGTCTGCGGGCAGGTCTTCATTCCGGAGGAACTGGCAGCCGGGAAAATCCTGCAGGTAGAACAGGCTTTGGAGGATAAATGA |
| Sequence | MSEKYYETYAFEPGSLVCDKCGTALEAGEVVLHYMGNDFPIEMPKCPVCGQVFIPEELAAGKILQVEQALEDK |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 31841667 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 626777 | 626998 | - | NZ_CP039126.1 | Blautia producta |
| 2 | 2982047 | 2982250 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 3 | 250838 | 251047 | + | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 4 | 2828692 | 2828904 | - | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 5 | 316140 | 316346 | - | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_021184.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04055.23 | 1.0 | 4 | 1337.0 | same-strand | Radical SAM superfamily |
| 2 | PF09719.12 | 1.0 | 4 | 612 | same-strand | Putative redox-active protein (C GCAxxG C C) |
| 3 | PF08241.14 | 1.0 | 4 | 50.0 | same-strand | Methyltransferase domain |
| 4 | PF13649.8 | 1.0 | 4 | 50.0 | same-strand | Methyltransferase domain |
| 5 | PF13534.8 | 1.0 | 4 | 6 | same-strand | 4Fe-4S dicluster domain |
| 6 | PF02754.18 | 1.0 | 4 | 6 | same-strand | Cysteine-rich domain |
| 7 | PF13183.8 | 0.75 | 3 | 46.0 | same-strand | 4Fe-4S dicluster domain |
| 8 | PF13237.8 | 0.75 | 3 | 0 | same-strand | 4Fe-4S dicluster domain |
| 9 | PF02738.20 | 1.0 | 4 | 2475.5 | same-strand | Molybdopterin-binding domain of aldehyde dehydrogenase |
| 10 | PF01799.22 | 1.0 | 4 | 2475.5 | same-strand | [2Fe-2S] binding domain |
| 11 | PF01315.24 | 1.0 | 4 | 2475.5 | same-strand | Aldehyde oxidase and xanthine dehydrogenase, a/b hammerhead domain |
| 12 | PF00994.26 | 0.75 | 3 | 5563 | same-strand | Probable molybdopterin binding domain |
| 13 | PF08242.14 | 0.75 | 3 | 95 | same-strand | Methyltransferase domain |
| 14 | PF13478.8 | 0.75 | 3 | 4128 | same-strand | XdhC Rossmann domain |
| 15 | PF02625.18 | 0.75 | 3 | 4128 | same-strand | XdhC and CoxI family |
++ More..