Result : EXP01151
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01151 |
| NCBI Accession ID | ABAX03000012.1 |
| Organism | Anaerostipes caccae (strain DSM 14662 / NCIMB 13811 / L1-92) |
| Left | 446634 |
| Right | 446852 |
| Strand | + |
| Nucleotide Sequence | ATGAAAATCTATACAGAAGTACAGTTTCAGAGTCACAATGTGCTCGTCGCAGATGTGGAAAAGGCAGTGAAGGAGGACATCAAATCAAAAGGTGTAAAATTAAATTCCCTGTCATCATTGGAAATCTATTATCAGCCGGAAAATTTGTCTGTATTTTATGTGGCAAAAGCAAAAGACGGCACTTCTATTTCTAATGAGGAACCGCTGAGCCTTGAATAA |
| Sequence | MKIYTEVQFQSHNVLVADVEKAVKEDIKSKGVKLNSLSSLEIYYQPENLSVFYVAKAKDGTSISNEEPLSLE |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 31841667 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1858673 | 1858891 | + | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 2 | 1943638 | 1943856 | + | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 3 | 299807 | 300025 | + | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP036345.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 0.67 | 2 | 5315 | same-strand | ABC transporter |
| 2 | PF01022.22 | 0.67 | 2 | 1475.5 | opposite-strand | Bacterial regulatory protein, arsR family |
| 3 | PF12840.9 | 0.67 | 2 | 1475.5 | opposite-strand | Helix-turn-helix domain |
++ More..