Result : EXP01149
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01149 |
| NCBI Accession ID | AE015928.1 |
| Organism | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) |
| Left | 2059776 |
| Right | 2059988 |
| Strand | - |
| Nucleotide Sequence | ATGGATGATATGATTAACAGACACGATTCGATTGCTGAGGAAAATATCGAACCGAATGGCCGTCCGGCTAAGAATGAGTTTGAAGAATGGAGCACTGAAGTTACCGATCGTGCAGATAATGTATTCAAAGGTGATACGAAAGACGGTCCCATCAAGGATCGTGAGAAACGAATAAAAGAAATGGATGAAGTGATAAAAAAGGACCTTGAATAA |
| Sequence | MDDMINRHDSIAEENIEPNGRPAKNEFEEWSTEVTDRADNVFKGDTKDGPIKDREKRIKEMDEVIKKDLE |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 31841667 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 70 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5637906 | 5638118 | - | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 2 | 2116839 | 2117051 | - | NZ_CP012938.1 | Bacteroides ovatus |
| 3 | 2875429 | 2875641 | - | NZ_CP015401.2 | Bacteroides caecimuris |
| 4 | 2762856 | 2763074 | - | NZ_LN877293.1 | Bacteroides fragilis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP040530.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03544.16 | 0.75 | 3 | 811 | same-strand | Gram-negative bacterial TonB protein C-terminal |
++ More..