Result : EXP01148
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01148 |
| NCBI Accession ID | AE015928.1 |
| Organism | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) |
| Left | 1397337 |
| Right | 1397546 |
| Strand | - |
| Nucleotide Sequence | ATGGTACTAGATAATAGTAACTCCCCCTATCACATAGAGGAAGAACTTTGGTTACAGATACTTTCTCTGTCAAGAGAGTTGCAGGAGTGTAAAGCTAGTCTGCACCATAATACTTTGGACTGTATTTCCGATAAGATTGAAGGAATAGAAAGAGAACTGGATGTCTTATTGGATATTCTGCAAGGGAGGCAAGACAAAAAGACATCATAG |
| Sequence | MVLDNSNSPYHIEEELWLQILSLSRELQECKASLHHNTLDCISDKIEGIERELDVLLDILQGRQDKKTS |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 31841667 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2431714 | 2431923 | + | NZ_CP054012.1 | Parabacteroides distasonis |
| 2 | 4375511 | 4375720 | - | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
| 3 | 4670659 | 4670868 | - | NZ_LR699004.1 | Phocaeicola dorei |
| 4 | 4975432 | 4975641 | - | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP054012.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01914.19 | 1.0 | 4 | 717.0 | same-strand | MarC family integral membrane protein |
| 2 | PF00210.26 | 1.0 | 4 | 1415.0 | same-strand | Ferritin-like domain |
| 3 | PF01791.11 | 1.0 | 4 | 1926.0 | same-strand | DeoC/LacD family aldolase |
| 4 | PF00300.24 | 1.0 | 4 | 2989.0 | same-strand | Histidine phosphatase superfamily (branch 1) |
++ More..