Protein Information |
Information Type | Description |
---|---|
Protein name | Photosystem II reaction center protein Ycf12 |
NCBI Accession ID | CP001037.1 |
Organism | Nostoc punctiforme (strain ATCC 29133 / PCC 73102) |
Left | 5892348 |
Right | 5892491 |
Strand | + |
Nucleotide Sequence | ATGTTTGACGCTGTATCTGACTTGGTTAACGCTTTTACCAGTATCAATTGGGAAGTTATTTTCCAATTGCTGTCCGTGGCGCTAATTGTAATTGCTGGCCCAGTAGTAATCTTTTTGTTGGCATTTCGCAACGGCAACCTATAA |
Sequence | MFDAVSDLVNAFTSINWEVIFQLLSVALIVIAGPVVIFLLAFRNGNL |
Source of smORF | Swiss-Prot |
Function | A core subunit of photosystem II (PSII). {ECO:0000255|HAMAP-Rule:MF_01329}. |
Pubmed ID | |
Domain | CDD:421560 |
Functional Category | Others |
Uniprot ID | B2IYZ8 |
ORF Length (Amino Acid) | 47 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 5892348 | 5892491 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
2 | 5974125 | 5974268 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
3 | 8337996 | 8338118 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
4 | 4888373 | 4888495 | - | NZ_CP031941.1 | Nostoc sphaeroides |
5 | 4229766 | 4229888 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
6 | 5751807 | 5751926 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
7 | 1815154 | 1815273 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
8 | 4122165 | 4122305 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
9 | 1221583 | 1221714 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
10 | 6078006 | 6078128 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
11 | 3270097 | 3270216 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
12 | 218089 | 218208 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
13 | 1149506 | 1149637 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
14 | 369010 | 369141 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
15 | 2960802 | 2960933 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
16 | 114428 | 114556 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
17 | 1408015 | 1408155 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
18 | 1287879 | 1288019 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
19 | 2706868 | 2706999 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03692.17 | 0.79 | 15 | 166 | opposite-strand | Putative zinc- or iron-chelating domain |
2 | PF17768.3 | 0.68 | 13 | 77 | opposite-strand | RecJ OB domain |
3 | PF02272.21 | 0.63 | 12 | 71.5 | opposite-strand | DHHA1 domain |
4 | PF01368.22 | 0.68 | 13 | 77 | opposite-strand | DHH family |