Result : EXP01145

Protein Information

• Protein name: EXP01145
• NCBI Accession ID: AE015928.1
• Organism: Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)
• Left: 1534435
• Right: 1534641
• Strand: +
• Nucleotide Sequence: ATGGAATATAACGTAAAAGAATTAAAAAAGGTATTGATTGAACAATGCAAAGAAGAAGGTATTTATTACGCATTGATAGCAATCAACAAACAAACGAAAGAGATCGTTTTGCCACAAAGCCTTGATAACGCTTTAAATAATCCGGATTACTGCGTCTTTAAATGCAGGAAAGTGAAGGATGAATATAAAGTAGAAGAGGTAAAATAA
• Sequence: MEYNVKELKKVLIEQCKEEGIYYALIAINKQTKEIVLPQSLDNALNNPDYCVFKCRKVKDEYKVEEVK
• Source of smORF: Protein-level
• Pubmed ID: 31841667
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 68

Conservation Analysis

No. of Species: 3

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	5112531	5112737	+	NZ_CP040530.1	Bacteroides thetaiotaomicron
2	468072	468284	-	NZ_CP012938.1	Bacteroides ovatus
3	1722310	1722522	-	NZ_CP015401.2	Bacteroides caecimuris

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_CP012938.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00393.21	0.67	2	2940.0	opposite-strand	6-phosphogluconate dehydrogenase, C-terminal domain
2	PF03446.17	0.67	2	2940.0	opposite-strand	NAD binding domain of 6-phosphogluconate dehydrogenase
3	PF02781.18	0.67	2	1270.0	opposite-strand	Glucose-6-phosphate dehydrogenase, C-terminal domain
4	PF00479.24	0.67	2	1270.0	opposite-strand	Glucose-6-phosphate dehydrogenase, NAD binding domain
5	PF01182.22	0.67	2	540.5	opposite-strand	Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase