Result : EXP01141
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01141 |
| NCBI Accession ID | CP036346.1 |
| Organism | Erysipelatoclostridium ramosum DSM 1402 |
| Left | 430865 |
| Right | 431065 |
| Strand | + |
| Nucleotide Sequence | ATGACAAAATATAAAGTGCGTAAAAAACCAATACTAGTTGATGCATATCAAACAGATCATTCTTTCTATATAGATACTTTAGAAGGTAGAATGAAGGCTGAAAAAGGTGATTGGATTATTACTGGTGTCAATGGTGAACGGTATCCCTGTAAACCAGAAATTTTTGAGAAAACTTATGATATTATAATAGAAGAAGGTTAA |
| Sequence | MTKYKVRKKPILVDAYQTDHSFYIDTLEGRMKAEKGDWIITGVNGERYPCKPEIFEKTYDIIIEEG |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 31841667 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 66 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1824067 | 1824249 | + | NZ_LS483436.1 | Streptococcus intermedius |
| 2 | 402807 | 403007 | + | NZ_CP023501.1 | Weissella paramesenteroides |
| 3 | 1133828 | 1134013 | - | NZ_CP029477.1 | Lactobacillus kullabergensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LS483436.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00589.24 | 0.67 | 2 | 1629.5 | opposite-strand | Phage integrase family |
| 2 | PF08937.13 | 0.67 | 2 | 11.5 | opposite-strand | MTH538 TIR-like domain (DUF1863) |
| 3 | PF14015.8 | 1.0 | 3 | 601 | opposite-strand | Protein of unknown function (DUF4231) |
| 4 | PF18181.3 | 1.0 | 3 | 601 | opposite-strand | SMODS and SLOG-associating 2TM effector domain 1 |
| 5 | PF01381.24 | 0.67 | 2 | 1127.5 | opposite-strand | Helix-turn-helix |
| 6 | PF12844.9 | 0.67 | 2 | 1127.5 | opposite-strand | Helix-turn-helix domain |
++ More..