Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01140 |
NCBI Accession ID | AE015928.1 |
Organism | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) |
Left | 1042538 |
Right | 1042732 |
Strand | + |
Nucleotide Sequence | ATGAAAACGGAAAAACAAAAAGAAACGAATGAAAAGGAAGTTCATTTGTTAGAACAAAAAGGATATGAAAGAATGGTCAATGAGATTGTTCCGGTACAACAAGCGGAAACTTACCGTAAACCGACCCAGAAAGCGGTAAAAGATGCTGTAAAGGAGTTGAATCCTGATACAAATAGTTTGGGTAGCAGAGGATGA |
Sequence | MKTEKQKETNEKEVHLLEQKGYERMVNEIVPVQQAETYRKPTQKAVKDAVKELNPDTNSLGSRG |
Source of smORF | Protein-level |
Function | |
Pubmed ID | 31841667 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 64 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4620634 | 4620828 | + | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
2 | 988576 | 988770 | - | NZ_CP012938.1 | Bacteroides ovatus |
3 | 2060811 | 2061005 | + | NZ_CP015401.2 | Bacteroides caecimuris |
4 | 2763830 | 2764003 | + | NZ_LN877293.1 | Bacteroides fragilis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13649.8 | 0.75 | 3 | 130 | opposite-strand | Methyltransferase domain |
2 | PF02518.28 | 0.75 | 3 | 64 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
3 | PF00158.28 | 0.75 | 3 | 1332 | opposite-strand | Sigma-54 interaction domain |
4 | PF14532.8 | 0.75 | 3 | 1332 | opposite-strand | Sigma-54 interaction domain |
5 | PF00072.26 | 0.75 | 3 | 1332 | opposite-strand | Response regulator receiver domain |
6 | PF02954.21 | 0.75 | 3 | 1332 | opposite-strand | Bacterial regulatory protein, Fis family |
7 | PF00004.31 | 1.0 | 4 | 1332 | opposite-strand | ATPase family associated with various cellular activities (AAA) |
8 | PF07728.16 | 1.0 | 4 | 1332 | opposite-strand | AAA domain (dynein-related subfamily) |
9 | PF02321.20 | 0.75 | 3 | 3008 | same-strand | Outer membrane efflux protein |
10 | PF12704.9 | 0.75 | 3 | 5913 | same-strand | MacB-like periplasmic core domain |
11 | PF02687.23 | 0.75 | 3 | 5913 | same-strand | FtsX-like permease family |