Result : EXP01140
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01140 |
| NCBI Accession ID | AE015928.1 |
| Organism | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) |
| Left | 1042538 |
| Right | 1042732 |
| Strand | + |
| Nucleotide Sequence | ATGAAAACGGAAAAACAAAAAGAAACGAATGAAAAGGAAGTTCATTTGTTAGAACAAAAAGGATATGAAAGAATGGTCAATGAGATTGTTCCGGTACAACAAGCGGAAACTTACCGTAAACCGACCCAGAAAGCGGTAAAAGATGCTGTAAAGGAGTTGAATCCTGATACAAATAGTTTGGGTAGCAGAGGATGA |
| Sequence | MKTEKQKETNEKEVHLLEQKGYERMVNEIVPVQQAETYRKPTQKAVKDAVKELNPDTNSLGSRG |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 31841667 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 64 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4620634 | 4620828 | + | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 2 | 988576 | 988770 | - | NZ_CP012938.1 | Bacteroides ovatus |
| 3 | 2060811 | 2061005 | + | NZ_CP015401.2 | Bacteroides caecimuris |
| 4 | 2763830 | 2764003 | + | NZ_LN877293.1 | Bacteroides fragilis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP040530.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13649.8 | 0.75 | 3 | 130 | opposite-strand | Methyltransferase domain |
| 2 | PF02518.28 | 0.75 | 3 | 64 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 3 | PF00158.28 | 0.75 | 3 | 1332 | opposite-strand | Sigma-54 interaction domain |
| 4 | PF14532.8 | 0.75 | 3 | 1332 | opposite-strand | Sigma-54 interaction domain |
| 5 | PF00072.26 | 0.75 | 3 | 1332 | opposite-strand | Response regulator receiver domain |
| 6 | PF02954.21 | 0.75 | 3 | 1332 | opposite-strand | Bacterial regulatory protein, Fis family |
| 7 | PF00004.31 | 1.0 | 4 | 1332 | opposite-strand | ATPase family associated with various cellular activities (AAA) |
| 8 | PF07728.16 | 1.0 | 4 | 1332 | opposite-strand | AAA domain (dynein-related subfamily) |
| 9 | PF02321.20 | 0.75 | 3 | 3008 | same-strand | Outer membrane efflux protein |
| 10 | PF12704.9 | 0.75 | 3 | 5913 | same-strand | MacB-like periplasmic core domain |
| 11 | PF02687.23 | 0.75 | 3 | 5913 | same-strand | FtsX-like permease family |
++ More..