ProsmORF-pred
Result : EXP01136
Protein Information
Information Type Description
Protein name EXP01136
NCBI Accession ID AP009048.1
Organism Escherichia coli (strain K12)
Left 1766648
Right 1766836
Strand -
Nucleotide Sequence ATGTCTACTCAACTTGATCCCACCCAGCTGGCCATTGAATTTTTACGCCGTGACCAGAGCAATCTTTCACCTGCCCAATATCTCAAACGTCTGAAACAACTAGAACTTGAATTTGCTGACCTGCTTACTCTCTCTTCTGCTGAATTAAAAGAAGAAATCTACTTTGCCTGGCGTCTGGGCGTGCATTGA
Sequence MSTQLDPTQLAIEFLRRDQSNLSPAQYLKRLKQLELEFADLLTLSSAELKEEIYFAWRLGVH
Source of smORF Protein-level
Function The ORF matches to the profile of pfam15930. Profile Description: Domain of unknown function. YdiH is a family of proteins found in bacteria. Proteins in this family are typically between 62 and 80 amino acids in length. The function is not known.
Pubmed ID 31841667
Domain CDD:318201
Functional Category Conserved domain based functional assignment
Uniprot ID P64477
ORF Length (Amino Acid) 62
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 52
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1747849 1748037 - NC_004337.2 Shigella flexneri 2a str. 301
2 1764934 1765122 - NC_000913.3 Escherichia coli str. K-12 substr. MG1655
3 2364783 2364971 - NC_002695.2 Escherichia coli O157:H7 str. Sakai
4 2053974 2054162 + NZ_LR134340.1 Escherichia marmotae
5 2070545 2070733 + NZ_CP061527.1 Shigella dysenteriae
6 1699586 1699774 - NZ_AP014857.1 Escherichia albertii
7 1644900 1645088 - NC_009792.1 Citrobacter koseri ATCC BAA-895
8 3848129 3848317 + NZ_CP053416.1 Salmonella bongori
9 1466756 1466944 + NC_013716.1 Citrobacter rodentium ICC168
10 1450057 1450245 + NC_003197.2 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
11 206683 206871 - NZ_CP044098.1 Citrobacter portucalensis
12 4858142 4858330 + NZ_CP033744.1 Citrobacter freundii
13 3606846 3607034 + NZ_LT556085.1 Citrobacter amalonaticus
14 1916858 1917052 + NC_015968.1 Enterobacter soli
15 710965 711153 + NZ_CP038469.1 Citrobacter tructae
16 3391372 3391560 - NZ_CP045205.1 Citrobacter telavivensis
17 393460 393648 + NZ_CP057657.1 Escherichia fergusonii
18 4418505 4418699 + NZ_AP019007.1 Enterobacter oligotrophicus
19 1890664 1890858 + NZ_CP017184.1 Enterobacter roggenkampii
20 588979 589173 - NZ_CP025034.2 Enterobacter sp. SGAir0187
21 1166220 1166414 + NZ_CP017279.1 Enterobacter ludwigii
22 2171804 2171998 + NZ_CP043318.1 Enterobacter chengduensis
23 1961259 1961453 + NZ_CP027986.1 Enterobacter sichuanensis
24 1956386 1956580 + NZ_CP009756.1 Enterobacter cloacae
25 826899 827093 + NZ_CP023529.1 Lelliottia amnigena
26 1504865 1505059 - NZ_CP045769.1 Enterobacter cancerogenus
27 1928019 1928213 + NZ_AP022508.1 Enterobacter bugandensis
28 554999 555187 + NZ_CP016337.1 Kosakonia sacchari
29 3017821 3018009 + NZ_CP051548.1 Phytobacter diazotrophicus
30 1999987 2000175 - NZ_CP011602.1 Phytobacter ursingii
31 2564232 2564420 - NZ_CP063425.1 Kosakonia pseudosacchari
32 2548295 2548483 + NZ_CP014007.2 Kosakonia oryzae
33 502953 503141 + NZ_CP045300.1 Kosakonia arachidis
34 2640726 2640914 - NZ_CP015113.1 Kosakonia radicincitans
35 2093143 2093331 + NZ_CP054058.1 Scandinavium goeteborgense
36 2378841 2379029 - NZ_CP012871.1 [Enterobacter] lignolyticus
37 2265609 2265797 + NZ_CP035129.1 Kosakonia cowanii
38 2402128 2402316 - NZ_CP045845.1 Kluyvera intermedia
39 2536411 2536599 + NZ_CP046672.1 Raoultella ornithinolytica
40 4735242 4735430 - NZ_CP026047.1 Raoultella planticola
41 2392885 2393073 + NZ_CP041247.1 Raoultella electrica
42 2592659 2592847 + NZ_CP050508.1 Raoultella terrigena
43 3734403 3734591 - NZ_CP020388.1 Pluralibacter gergoviae
44 2547145 2547333 - NZ_CP023525.1 Cedecea neteri
45 1754529 1754717 + NC_017910.1 Shimwellia blattae DSM 4481 = NBRC 105725
46 2678139 2678327 + NZ_CP060111.1 Klebsiella michiganensis
47 2751945 2752133 + NZ_CP036175.1 Klebsiella huaxiensis
48 2726158 2726346 - NZ_CP065838.1 Klebsiella quasipneumoniae
49 2936828 2937016 - NZ_CP054254.1 Klebsiella variicola
50 2811621 2811809 - NZ_LR134475.1 Klebsiella aerogenes
51 2467492 2467680 + NC_016845.1 Klebsiella pneumoniae subsp. pneumoniae HS11286
52 2389764 2389952 - NZ_LR134201.1 Cedecea lapagei
53 4494388 4494576 - NZ_CP040428.1 Jejubacter calystegiae
++ More..