Protein Information |
Information Type | Description |
---|---|
Protein name | Photosystem I reaction center subunit PsaK (Photosystem I subunit X) |
NCBI Accession ID | CP001037.1 |
Organism | Nostoc punctiforme (strain ATCC 29133 / PCC 73102) |
Left | 5694450 |
Right | 5694710 |
Strand | + |
Nucleotide Sequence | GTGTTTACTTCAACCTTACTCGCTGCTGCAACTACACCCCTGCAATGGAGTCCGACAGTTGGACTGATTATCATTATTGCTAATATCATTGCCATTGCCTTTGGGAAATCGACCATCAAATATCCCAATGCAGAACCAGCACTACCCTCATCTAATCTTTTTGGTGGTTTTGGTTTACCAGCCCTTTTAGCAACCACTGCCTTTGGTCATATCTTAGGAGTGGGCGCTGTTTTAGGGCTGCATAACCTGGGAAGAATTTAG |
Sequence | MFTSTLLAAATTPLQWSPTVGLIIIIANIIAIAFGKSTIKYPNAEPALPSSNLFGGFGLPALLATTAFGHILGVGAVLGLHNLGRI |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl11425. Profile Description: Photosystem I psaG / psaK. Members of this protein family are the PsaK of the photosystem I reaction center. Photosystems I and II occur together in the same sets of organisms. Photosystem I uses light energy to transfer electrons from plastocyanin to ferredoxin, while photosystem II uses light energy to split water and releases molecular oxygen. [Energy metabolism, Photosynthesis] |
Pubmed ID | |
Domain | CDD:416266 |
Functional Category | Others |
Uniprot ID | B2IWT4 |
ORF Length (Amino Acid) | 86 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 5694450 | 5694710 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
2 | 6636350 | 6636610 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
3 | 5377669 | 5377929 | + | NZ_CP031941.1 | Nostoc sphaeroides |
4 | 2918231 | 2918491 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
5 | 4312355 | 4312615 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
6 | 5255262 | 5255522 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
7 | 861227 | 861487 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
8 | 2862118 | 2862381 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
9 | 2062307 | 2062573 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
10 | 2488784 | 2489053 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
11 | 6066200 | 6066460 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
12 | 4037223 | 4037507 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
13 | 3147658 | 3147921 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
14 | 804113 | 804367 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
15 | 643975 | 644211 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
16 | 1126208 | 1126477 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
17 | 1097947 | 1098207 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
18 | 2921623 | 2921871 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
19 | 1038290 | 1038535 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
20 | 763850 | 764098 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
21 | 5800991 | 5801257 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
22 | 966746 | 967015 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |